KEGG   Flavobacterium johnsoniae: Fjoh_1841Help
Entry
Fjoh_1841         CDS       T00508                                 

Definition
phosphodiesterase I (EC:3.1.4.1)
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
fjo  Flavobacterium johnsoniae
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:fjo00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:fjo00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:fjo02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2121650..2122852)
Genome map
AA seq 400 aa AA seqDB search
MKKHFTSLLSLIFLSLSFFLQAQNTKDNYVVLVSMDGFRWDYAKQFNLQNLPQIAKQGVH
AKSMKPSYPTKTFPNHYAIVTGLYPDHHGIINNVFYDADLNESFSLSSKAKSDSRFYGGN
PIWNVAEQQGVKAASFFWPGSDIDKRNPSYYKDYDNKIPYGARIDTVLKWLQLPEKQRPH
LVTLYFDEPDHSGHNFGPLSPETKKAATKMDSIMGELSRKLDQLPIGKQINLIIVSDHGM
ADISNDKKVAVLDYLKPEWLGYKDVINPIMSLQAKAGYQDSIANALKKVPHIKFWKSTEV
PERLHYGTNPRVHDFVIEAEKGWSLVSKESTHIKGGTHGYDNENKDMHAVFYAKGPAFKV
NKEVKTFQNVSVYPLIAHILGLQIDQVDGKLSDVKSMLVN
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagcattttacctcgctcctgtctttaatttttctttcactttcattcttttta
caagcccaaaataccaaagataattatgttgttttagtttctatggatggttttagatgg
gattatgccaagcagtttaatcttcaaaatctgccgcagattgctaaacaaggtgttcat
gcaaaatcgatgaaaccttcttatcctaccaaaacttttccaaatcattacgctattgta
acaggactttatccggatcatcacgggattattaataatgttttttacgatgctgattta
aacgaatctttttcattgtcaagtaaagcaaaaagtgattctcgtttttatggcggaaac
cctatttggaatgtcgctgaacagcaaggagtaaaagcagcttctttcttttggccggga
tctgatatcgacaaaagaaatccaagttattacaaagattatgacaataaaattccgtac
ggagccagaatagacacagttctaaaatggctgcagcttccggaaaaacaaagacctcat
ctggttactttatattttgatgaaccagatcattcaggacataattttggtccgctttcg
cctgaaactaaaaaagcagcaacaaaaatggattctattatgggagaattatcccgtaaa
ttagatcaactgcctattggaaaacaaatcaatttaattatcgtttcagatcacggaatg
gccgatataagcaacgataaaaaagtagcggttctggattatttaaaaccagaatggctg
ggttacaaagatgtaattaacccaataatgagtctgcaggccaaagccggttatcaggat
tctattgcaaatgctttgaaaaaagtaccgcatattaaattctggaaatctaccgaagtt
cctgaaagactgcattacggaactaatccgcgtgtacatgactttgttattgaagctgaa
aaaggatggagtttagtaagcaaagaaagcactcatataaaaggcggaactcacggttac
gacaatgaaaacaaagatatgcacgctgttttttatgcaaaaggacctgcttttaaagta
aacaaagaagtcaaaacttttcaaaacgtttctgtttaccctttaatagcacatatttta
ggattgcagattgatcaagttgacgggaaattaagcgatgtaaaatcaatgctggttaat
tag

DBGET integrated database retrieval system