KEGG   Flavobacterium johnsoniae: Fjoh_1996Help
Entry
Fjoh_1996         CDS       T00508                                 

Definition
endo-1,4-beta-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
fjo  Flavobacterium johnsoniae
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2329837..2330946
Genome map
AA seq 369 aa AA seqDB search
MKFINPYLLAISTVFFVNCSSNKETLTLKDSYKNDFYIGTALSADQIEEKDAKVDSLIRT
EFNAITAENIMKSMYTHPQKDKYDFTLSDKFVAYGEKNKMFIHGHTLIWHSQLAPWMEKI
ADSTEMKAFMKDHITTIVSKYKGRINSWDVVNEALNEDGTLRPSVFLKTLGEKYLVDAFK
LAAKADPKVDLYYNDYNIEEPAKRAGAIALIKKIKAEGGKIDGVGIQGHWRLHSPSIEEI
EKSILEYSALGIKVAFTELDITVLPNPWDLKGADVNQNFEGSAKMNPYPKTLPDSVQTKL
AERYASIFKLFLKHKDKISRVTFWGVYDGQSWLNDWPIKGRTNYPLPFDKDLKHKPAYDS
ILKLNKTEE
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttattaacccttatttgctcgcgatcagtaccgtattttttgtaaattgttct
tctaacaaggaaacgttaaccttaaaagattcttataaaaacgatttttatattggaact
gctttgagcgcagatcaaattgaagaaaaagatgcaaaagttgattcattaatccgaaca
gaatttaatgcaattacagcagaaaacatcatgaaatcgatgtacacgcatccgcaaaaa
gataaatatgattttactttatcggacaaatttgtagcttacggagagaaaaataaaatg
ttcattcatggacatactttaatttggcacagtcagttagcgccctggatggaaaaaatc
gcagacagcactgaaatgaaagcctttatgaaagatcatatcacaacaattgtttcaaaa
tacaaaggcagaatcaattcgtgggatgttgtaaatgaagctttaaacgaagatggaact
ttaagaccgtctgtttttttgaaaacgcttggtgaaaaatatcttgttgatgcttttaaa
ctggcagcaaaggcagatccaaaagtagacttgtattacaacgattataatattgaagaa
ccggcaaaaagagccggagcaattgctttaattaaaaagataaaagcagaaggcggaaaa
attgatggtgttggaattcagggacattggagactgcatagtccatcgatagaagaaatt
gaaaagagtattttagaatattcggcattaggaattaaagttgcttttacagaattggat
attaccgttttaccaaatccgtgggatttaaaaggagccgatgtaaatcagaattttgaa
ggaagtgccaaaatgaatccgtatcctaaaacattgccggattctgttcagactaaattg
gcagaacgttatgcatcgatttttaaattgttcttaaaacataaagataaaataagcaga
gttactttttggggagtttatgacggacaatcatggttaaatgactggcctataaaagga
agaaccaattatccgcttccgtttgataaagatttgaaacacaaaccggcttacgatagt
attttaaagttaaataaaacggaagaatag

DBGET integrated database retrieval system