KEGG   Flavobacterium johnsoniae: Fjoh_2026Help
Entry
Fjoh_2026         CDS       T00508                                 

Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
fjo  Flavobacterium johnsoniae
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:fjo00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:fjo00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2376502..2377680
Genome map
AA seq 392 aa AA seqDB search
MKNIQIAAVVLLALFQFNCKDNKKENSTSKETAAIQSDSTKTVLQTKNFDTIIDGKKVGL
YWIENKGIKAAFTNYGGRLIGLWVNDKNGKSTDVVVGMNSAKGFKTSTEPYFGATIGRVG
NRIGKGKFTLEGKQYQVPLNNGKNALHGGVKGFQDVVWNAEKTNENILVFTYVSPDGEQG
FPGNLSVKVTYTITDDNSVQMEYEATTDKTTIVNLTNHAFLNLNGEGSGTILNHELQIYA
NEFTPVDEGLIPNGELKPVKNTPFDFTSKHTIGERIETKDEQLKFGKGYDHNYVLNGTKK
NGLNHAATISGDKSGITLDIFTQEPGLQFYSGNFMQSKNTFKSGAKDDFRTAFALETQHF
PDAPNQPKFAPIVLKPGEKYHTVSYYQFSVKK
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatatccaaatagcagctgtcgttttactggcgctttttcagtttaattgtaag
gacaataaaaaagaaaattccacttcaaaagaaactgctgcaatacaatcagattcaaca
aaaactgttttacaaactaaaaatttcgatacgataatcgacggaaaaaaagttggctta
tactggatcgaaaacaaaggtattaaagccgcttttaccaattacggcggaagactaatc
ggactttgggtaaacgataaaaatggaaaatcaaccgatgttgttgtgggaatgaacagt
gcaaaaggttttaaaacctcaacagaaccttactttggagctacaattggaagagttgga
aaccgaataggaaaagggaaatttacattagaaggaaaacaatatcaagttccgttaaat
aatgggaaaaatgccttgcatggtggtgtaaaaggttttcaggatgtagtttggaatgcc
gaaaaaacaaacgaaaacattctggtttttacctatgtttcaccagacggcgaacaaggt
tttcctggaaatttatctgtaaaagtaacctatacgattactgatgataattcggttcaa
atggagtatgaagcaactacagataaaacaacaattgtcaatttaaccaatcatgctttt
ttaaatttaaacggagaaggaagcggtacaatcttaaatcacgaattacagatctatgcc
aacgaatttactcccgttgacgaaggtttgattccaaacggtgaattaaaaccagtaaaa
aatacgcctttcgattttacttcaaaacataccattggcgaaagaattgaaacgaaagat
gaacagttgaaatttggaaaaggctacgaccacaattacgttttaaacggaactaagaaa
aacggattaaatcatgctgcaacaatttctggtgataaatcgggaatcacgcttgatatt
tttacacaagaaccgggattacagttttacagcgggaatttcatgcagtcaaaaaacacc
tttaaaagtggtgcaaaagacgattttagaactgcttttgctttagaaacacagcatttt
ccagacgcgccaaatcagccaaaatttgctccgattgttttaaaacccggagaaaaatat
catacagtttcttattatcagttttctgtaaaaaagtag

DBGET integrated database retrieval system