KEGG   Flavobacterium johnsoniae: Fjoh_2038Help
Entry
Fjoh_2038         CDS       T00508                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
fjo  Flavobacterium johnsoniae
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fjo00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Fjoh_2038
  Lipid metabolism
   00600 Sphingolipid metabolism
    Fjoh_2038
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Fjoh_2038
Enzymes [BR:fjo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Fjoh_2038
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2394504..2397644
Genome map
AA seq 1046 aa AA seqDB search
MKKTVSILTLLLTTALSVNAQEKVPFWQNEKINEDNREPMHAAYYVFENETLAAKNEWRQ
SKNYLDINGAWKFKYVENPAALPKDFEKTNFDDKSWDNFKIPASWDVNGYGYPVYVNTTY
DFDYLMAPNPPFVPTKYNPTGVYRREINIDKSWEGKDIFLHIGTAKSNLTVWVNGIYVGY
GEDGKLPSEFKLNKYVKTGKNTIALQVMKWNDGSYLECQDMWRMSGITRDSYLVARNKAH
LNDFEIIPDLDENYVNGSLKISTQFSNLNTKDSYTLDVQLKDGDKVITSKVITASNEKQT
FDFKVENPKKWSAEIPNLYQVRFILKDKKGNIIEVINHNVGFRKVEIKGGQLLVNGKAIY
IKGVNRHEVDPITGQTISRERMEQDIKLMKEFNINAVRMSHYPNDEYFYELCDKYGIYVV
DEANIESHGMGYDITKTLGNRPDWELAHIERMQRMIERDKNHTSIIIWSMGNEAGNGYNF
YRGYLWIKNRDKSRPIQYERATAGAWDGKDLKFEWDSDIIDPMYSSPNKMEEYILANPNP
SRPYIQCEYAHAMGNSMGNFKDYWDVIRKYPNFQGGFIWDMIDQSVYKKLDNGTTILAYG
GDFGPKDVKSDNNFVNNGVFTVDRKPNPHAFEVKNVHQNIHTSWENQETATIKVYNEFSF
KDLSNVTLHWELFLDGVKDATGIIDYLAIDPTQSKTYTLPIKLGDKKFQEAFINISYQLK
QEEPFLPKGFEIATEQLAYKGTWKNDISVKGDGKITVEKKVNATVFKSDKTEITFDKKTG
FISGYSFNNQPIIKEGYQLRPNFWRAPNDNDFGANFQVNLKAWKDATENPTLVNWTFTPS
KDNKVVVKATYSLPQVSSTLELNYEFNGNGELAVKEVLNIDKNKEQPILPRFGMEVIVPR
DFSNMTYYGRGPHENYIDRNYSSKVGLYTQTVSEQYYPYIRPQETGNKTDVRFLELSGDK
LKLTVTSDELLAVTALHFLNEDLDDGLQKDQRHAAELKERDLTSLKIDSKQMGVGGIDSW
QAWPMEKYLLRGKNYQYQFKITPSLK
NT seq 3141 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacagtatccatattaaccttattacttactacagcattatctgttaacgca
caggaaaaagttccgttttggcagaatgagaaaatcaatgaagataatagagagcccatg
cacgccgcctattatgtttttgaaaatgaaacattagctgctaaaaacgaatggagacaa
tctaaaaattacttagacattaacggagcctggaaatttaaatatgttgaaaatccggct
gcgcttccaaaagattttgagaaaaccaattttgacgataaaagctgggataattttaaa
attccggcaagctgggatgtaaacggatatggatatccggtttatgtaaatacaacttac
gattttgattatttaatggcgccaaatccgccgtttgtgccaacaaaatataatcctaca
ggagtttacagacgagaaatcaacattgacaaatcgtgggaaggaaaagatatttttctt
catattggtacagctaaatcaaatttaacggtatgggtaaatggtatttatgtaggttat
ggagaagatggaaaattaccatctgaattcaaattaaacaaatatgtaaaaaccggaaaa
aatacaattgcacttcaggtaatgaaatggaatgacggttcgtatttagaatgtcaggac
atgtggagaatgagcggtattacccgtgattcttatttagttgccagaaacaaagcgcat
ttaaatgactttgaaattattccggatttagatgaaaattacgtaaacggaagtttgaaa
atctcaactcaattttcaaatttaaatacaaaagacagttacactttagacgttcaatta
aaagacggagacaaagttattacttcaaaagttattacagcttcaaacgaaaaacaaacg
tttgattttaaagtagaaaatccaaagaaatggagtgcagagattccgaatttatatcag
gtacgttttattctaaaagataaaaaagggaatataattgaagttatcaatcacaacgtt
ggatttagaaaagtagaaattaaaggcggacagcttttagtaaacggaaaagcgatttac
ataaaaggagtaaaccgtcatgaagtagatccaattacaggacagacaatttcaagagaa
agaatggaacaggatattaaattgatgaaagaatttaatatcaatgccgtgagaatgtcg
cattatccaaatgacgaatatttctacgaattatgcgataaatacggaatttatgtggtt
gatgaagccaatatagaatcgcacggaatgggttatgatattaccaaaacgcttggtaat
agaccagactgggaactggcgcacattgagcgtatgcagcgtatgatcgaaagagataaa
aaccacacatcaatcattatctggagtatgggtaacgaagccggaaacggttacaacttt
tacagaggatatttgtggattaaaaaccgtgataaatcaagaccaattcagtacgaaaga
gcaactgcgggcgcttgggacggaaaagatttaaaattcgaatgggattctgatattatc
gacccaatgtacagttctccaaacaaaatggaagaatatattctggcaaatccaaacccg
tcaagaccttacattcagtgcgaatatgcgcatgcaatgggaaattcaatggggaatttt
aaagattactgggatgtaattcgtaaatatccaaactttcagggtggtttcatttgggac
atgatcgatcagtcagtttataaaaaactggataacggaactacaattttagcttacgga
ggagattttggacctaaagacgtaaaaagcgataacaactttgtaaacaacggagttttt
acagtagacagaaaaccaaatcctcatgcttttgaagtaaaaaatgtgcatcaaaatatt
cacacttcttgggaaaatcaggaaactgcgactataaaagtatacaatgaattttcattt
aaagacttgagcaatgttactttacattgggaattgtttttagacggagttaaagatgca
acaggaattatcgattatctagcgattgatccaacgcagtcaaaaacctatacactgcca
attaaattaggtgataaaaagtttcaggaagcttttatcaacattagttatcagttaaaa
caagaagaaccatttttaccaaaaggattcgaaattgcaacagaacaactggcttacaaa
ggaacgtggaaaaatgatattagtgtaaaaggagatggaaaaattacagttgagaaaaaa
gtaaatgcaaccgtttttaaaagcgataaaactgaaattactttcgacaagaaaaccgga
tttatcagcggttattcattcaataatcagccgataataaaagaaggataccaattacgc
ccgaatttctggagagcaccaaatgataatgattttggcgctaattttcaggtaaattta
aaagcatggaaagatgcaacagaaaatccaacattggtaaactggacatttacgccatca
aaagacaataaagttgtagtaaaagcaacttacagcttaccgcaggtttcttcgacttta
gaattgaattatgaatttaacggaaacggagaattagcggtaaaagaagttttaaatatt
gataaaaacaaagaacagcctatcttgccaagatttggaatggaagtaattgttcctaga
gattttagcaatatgacctattacggaagaggccctcacgaaaattacattgacagaaat
tacagttcaaaagtgggattgtatacacaaacagtttcagagcagtattatccatacatc
cgtccgcaggaaaccggaaataaaaccgatgtgcgtttcttagaattatcaggcgataaa
ttaaaattaaccgtaacatctgacgaattattggccgtaactgctttacatttcttaaac
gaagatttagacgacggactgcagaaagaccaaagacacgctgccgaattgaaagaaaga
gatttaacaagtttaaaaatcgattcgaaacaaatgggagtaggaggaatagacagctgg
caggcatggccaatggaaaaatatcttttgagaggaaaaaattatcagtatcaatttaaa
ataacaccatcattaaaataa

DBGET integrated database retrieval system