KEGG   Flavobacterium johnsoniae UW101: Fjoh_2270Help
Entry
Fjoh_2270         CDS       T00508                                 

Definition
(GenBank) GTP cyclohydrolase
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
fjo  Flavobacterium johnsoniae UW101
Pathway
fjo00790  Folate biosynthesis
fjo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fjo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Fjoh_2270
Enzymes [BR:fjo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Fjoh_2270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI DUF1598 Phage_holin_6_1 MTTB
Motif
Other DBs
NCBI-ProteinID: ABQ05297
JGI: Fjoh2270
UniProt: A5FHM7
Position
complement(2735506..2736177)
Genome map
AA seq 223 aa AA seqDB search
MINNEDFLDEIGDSHFSSNAKNPLREDAFDITDEEKIEKIKKDVENILQTLGMDLTDDSI
KGTPNRVAKMFVKEIFGGLNPAKQPKASTFDNNYKYGEMLVEKNITVYSTCEHHLLPIIG
RAHVAYISSGRVIGLSKMNRIVEYYAKRPQVQERLTMQIVQELQKALGTEDVACVIDAKH
LCVNSRGIKDIESSTVTSEFGGKFKDPQTKREFLDYIKLDTQF
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgataaataacgaagattttttagacgaaataggtgacagtcatttcagcagtaatgca
aaaaaccctttaagagaggatgcttttgatataactgatgaagaaaaaatagaaaaaatt
aaaaaagatgttgaaaacattcttcagactcttggaatggatttaacagatgacagcata
aaaggtactccaaaccgagtagctaaaatgtttgtaaaagaaatttttggaggtttaaat
cctgcaaaacagccaaaagcctcaacttttgacaataattacaaatatggcgaaatgctg
gtagaaaaaaacattaccgtttattctacctgtgaacaccacttactgccaattatagga
cgtgctcacgttgcttatatttcaagcggaagagttattggtttatcaaaaatgaaccgt
atcgttgagtattatgctaaaagacctcaggtacaagagcgtttaacaatgcagattgtt
caggaacttcaaaaagctttaggaacagaagatgtagcctgcgttatcgatgcaaaacac
ctttgtgttaactcaagaggaatcaaagatatcgaaagcagtactgtaacttctgaattc
ggcggaaaattcaaagatcctcaaacaaaaagagaatttcttgattacattaaactagat
acacagttctaa

DBGET integrated database retrieval system