KEGG   Flavobacterium johnsoniae: Fjoh_2573Help
Entry
Fjoh_2573         CDS       T00508                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
fjo  Flavobacterium johnsoniae
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:fjo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Fjoh_2573
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Fjoh_2573
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Fjoh_2573
Enzymes [BR:fjo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Fjoh_2573
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3059408..3060697)
Genome map
AA seq 429 aa AA seqDB search
MKYYSLNHNAPKVSFQEAVIQGLATDKGLYFPESITPLDPSFFDKIESLSHEEIAFEAIK
QFVGDEIPAEKLKEIIAETLVFDFPVVKVENGIYSLELFHGPTMAFKDVGARFMSRCLGY
FNKDKKDAKNTVLVATSGDTGGAVASGFLGVDGVDVVILYPSGKVSDIQEKQLTTLGQNI
KALEVDGVFDDCQDMVKKAFLDETLAHKNLTSANSINIARWLPQMFYFFFAYKALKSQNK
PLVFSCPSGNFGNICAGIMAKKLGLPIEHFVASTNVNDTVPRFLENGKYDPKPSKATISN
AMDVGNPSNFIRIQELYNNDLKAFEKDFSSYSYTDEETLEALKKIYNADGYIAEPHGAVG
YLGLKKELEKHPNAIGVFLETAHPIKFLDVVEPALGITLPIPAQIESVINEEKVSVKIRT
YEELKSFLG
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaaatactacagtttaaaccataatgccccaaaagtttcttttcaggaagctgttata
caaggattagcaactgacaaaggattatatttcccagaaagcattacaccgcttgatcct
tcattttttgataaaatcgaaagtttaagccatgaagaaattgcttttgaagcgattaaa
caatttgttggcgacgaaattccagcagaaaaactaaaagaaatcattgctgaaacttta
gtttttgattttccagttgtgaaagtcgaaaacggaatctattcgttagaattatttcac
gggccgacaatggcgtttaaagacgttggagcgcgttttatgtcgcgttgtctgggctat
ttcaataaagacaaaaaagacgctaaaaacaccgttttagtagctacatccggagataca
ggcggagctgttgcaagcggatttcttggcgttgacggcgttgatgttgtcattttatat
ccgtcaggaaaagtgagcgatattcaggaaaaacaattgacgactttagggcaaaacatt
aaagcacttgaagttgacggtgtttttgacgattgtcaggatatggtgaaaaaagcgttt
ttagacgaaactttagcgcataaaaacctgacttcggctaactctattaatattgcgcgc
tggttaccgcaaatgttttatttcttctttgcttacaaagcattaaaaagccaaaacaaa
cctttagttttctcttgcccaagcggaaacttcgggaatatctgcgccggaattatggca
aaaaaattaggtttgccgattgaacatttcgttgcgtctacaaacgtaaacgacaccgtg
ccaagattcttagaaaacggaaaatacgacccgaaaccttctaaagcaacaatctctaac
gccatggacgttggaaacccaagcaactttattagaattcaggaattgtacaataatgac
ttaaaagctttcgaaaaagatttctcttcttatagttataccgatgaagaaacgcttgaa
gcgctaaagaaaatctataacgcagatggttacattgcagaaccgcacggcgctgttggt
tatttaggtttgaaaaaagaactagaaaaacaccccaacgcaattggtgttttcttagaa
acagcgcatcctattaaattcttagatgttgttgaaccggcgctaggaattacacttcct
attcctgctcaaattgagagtgttattaatgaggagaaagttagtgtgaagattaggact
tatgaggagttgaagagtttcttggggtag

DBGET integrated database retrieval system