KEGG   Flavobacterium johnsoniae: Fjoh_2745Help
Entry
Fjoh_2745         CDS       T00508                                 

Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
fjo  Flavobacterium johnsoniae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fjo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Fjoh_2745
Enzymes [BR:fjo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Fjoh_2745
Exosome [BR:fjo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Fjoh_2745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3274873..3276777
Genome map
AA seq 634 aa AA seqDB search
MTKVIVHSLFTDFDIDLFKAGKHFKLYEKLGAHLIEVNGVKGVYFAVWAPTAQSVSVVGD
FNYWTQGEHNLNVRWDSSGIWEGFIPDISKGALYKYKIQSSINGVITEKADPFALYCEKP
PHTASVVWDLDYKWKDENWMQNRQQHNALDKPYSVYEVHLGSWKRADHNRFLSYLELADD
LVKYVKETGFTHVEFMPIMEYPYDPSWGYQLTGYFAPTSRFGKPQDFMVLVDRLHQEGIG
VILDWVPSHFPDDAHGLGYFDGSHLYEHPDRRKGYHPDWKSLVFNYGRNEVRAFLISNAV
FWLQNYHVDGLRVDAVASMLYLDYSRKEGEWEANIFGGRENLDSISFLKEFNEVIYANFY
GVQTIAEESTSFPMVSRPTFTGGLGFGMKWMMGWMHDTLKYFQKETVYRKYHQNDLTFSM
TYAFTENFMLPFSHDEVVYGKQSLIYKMPGDEWQRFANLRLLYGYMFTHPGTKLLFMGAE
FGQTSEWNFEQSLDWHLLQYDFHSGIKRLITDLNQLYKSQPALYEKQFTADGFEWINYSD
HQNAVLSYIRKGNNPDENVIVVCNFTQVVRENYRIGISKKGKLEEIFNSDASIYGGSGIE
NGKSLKIESIPYDGREFSVELILPPLSVTVYSFS
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atgactaaagtaatcgtacattctctatttaccgattttgatatagatttattcaaagcg
ggaaaacacttcaaattatatgaaaaattaggagcacatttaattgaagttaatggagta
aaaggcgtttattttgccgtttgggctcccacggcacagtcggtttcggttgtgggcgat
tttaattactggacacaaggcgaacacaatttaaatgttcgctgggattcttctggaatt
tgggaaggatttattcccgatatttcaaaaggagctctttataaatataaaattcaatcg
agtataaatggtgtaattactgaaaaagcagatccttttgctctttattgtgaaaaacca
ccgcatacggcttctgttgtctgggatttagactataaatggaaggatgaaaactggatg
cagaaccgccagcagcataatgctttagataaaccatattctgtttatgaagttcattta
ggttcctggaaacgagctgatcataacaggtttttaagttatttagaactggcagatgat
ctggtaaaatacgttaaagaaaccggttttacgcatgttgaatttatgccgattatggaa
tatccttatgatccttcatggggttatcagttaacaggatattttgcgccgacttcgcgt
tttggaaaaccacaggactttatggttttggttgacaggctgcatcaggaaggaattgga
gtgattctggactgggttccgtcgcattttccagatgatgcgcatggtttaggttatttt
gacggttctcatttatatgaacatccagatcgtagaaaaggctatcatccggattggaaa
agcttggtttttaattatggaagaaatgaagtccgcgcttttttaatcagcaatgctgtt
ttctggcttcaaaattatcatgtagacggattaagagtagatgctgtggcctcgatgttg
tatcttgattattccagaaaagaaggcgagtgggaagccaatatttttggcggaagagag
aatttagacagtataagttttcttaaagaatttaatgaagttatttatgctaatttttat
ggagttcagactattgcagaagaaagcacttcatttcctatggtttccagaccaaccttt
accggaggtttaggttttggaatgaaatggatgatgggctggatgcacgatactttaaaa
tattttcaaaaagaaacggtttatagaaaataccatcaaaacgatttgacgttttcgatg
acatacgcttttaccgaaaactttatgcttccgttttctcatgacgaagttgtttacggc
aaacaatctctaatttataaaatgccgggcgacgaatggcagcgatttgctaatttaaga
ttgttgtacggttatatgttcacgcatccgggaactaaattattgtttatgggggcagaa
tttggtcaaaccagcgaatggaattttgaacaaagtttagactggcatttactgcaatat
gattttcattctggaataaagagattaattacagatttaaatcagttatataaatctcaa
cctgcattgtatgaaaagcaatttacagcagatggttttgaatggataaattattcagat
catcaaaatgcggttttatcttatatccgaaaaggaaataatccagatgaaaatgtcatt
gtagtttgtaatttcacgcaggtagtacgtgaaaattatagaattggaatttctaaaaaa
ggaaaattagaagaaatttttaatagtgatgcttctatttatggaggaagcggcatagaa
aatggaaaatctctaaaaatcgaatcaattccgtatgatggcagggaattttcagtcgaa
ttaattttaccgccattaagtgtaacggtatattctttcagttag

DBGET integrated database retrieval system