KEGG   Flavobacterium johnsoniae: Fjoh_2944Help
Entry
Fjoh_2944         CDS       T00508                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
fjo  Flavobacterium johnsoniae
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:fjo00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:fjo00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3490123..3490710)
Genome map
AA seq 195 aa AA seqDB search
MKKILFIACSAIFFISAQAEAQTSKNKLSKSDKAMAKETIYQFKVEDLSGDTFDFASLKG
KKILIVNTASKCGLTPQYKDLEAVYKEYKDKGFVIVGFPANNFASQEPGTNKEIETFCQQ
NYGVTFPMMNKVSVKGDDMCDVYKFLTQKSKNGLQDSEVEWNFQKYLINEKGELVKVIKP
RTLVTEPEVINWIKS
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatactatttatagcttgcagtgccattttttttataagtgcacaagctgag
gctcaaacaagcaagaataaattatctaaatcagataaggctatggcaaaagaaacaatt
taccagtttaaagtagaagatttatcaggagacacttttgattttgcgtctttaaaaggc
aaaaaaatcttaattgtaaatacagcatcaaaatgcggtttaacgcctcaatacaaagat
cttgaagctgtttataaagaatacaaagataaaggatttgtaattgttggttttcctgca
aacaacttcgcatcgcaagagcctggaacaaacaaagaaattgaaactttctgccagcag
aattacggtgtaacttttcctatgatgaacaaagtttctgtaaaaggagatgatatgtgc
gatgtttacaaattcctgactcaaaaatctaaaaacggtttacaggattctgaagttgaa
tggaattttcaaaaatacctgattaatgaaaaaggtgaattggttaaagtaatcaaacct
agaactctagtaacagagccagaagtaattaattggataaaaagctaa

DBGET integrated database retrieval system