KEGG   Flavobacterium johnsoniae UW101: Fjoh_3118Help
Entry
Fjoh_3118         CDS       T00508                                 

Definition
(GenBank) Candidate beta-galactosidase; Glycoside hydrolase family 2
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
fjo  Flavobacterium johnsoniae UW101
Pathway
fjo00052  Galactose metabolism
fjo00511  Other glycan degradation
fjo00600  Sphingolipid metabolism
fjo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fjo00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Fjoh_3118
  Lipid metabolism
   00600 Sphingolipid metabolism
    Fjoh_3118
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Fjoh_3118
Enzymes [BR:fjo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Fjoh_3118
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_C Bgal_small_N Glyco_hydro_2_N Glyco_hydro_2 DUF4981 DUF4968 BetaGal_dom4_5 CBM60
Motif
Other DBs
NCBI-ProteinID: ABQ06135
JGI: Fjoh3118
UniProt: A5FF80
Position
complement(3694041..3697172)
Genome map
AA seq 1043 aa AA seqDB search
MQKTKIFFISLLLLFSAGIWAQEKDRNDWENPEVFQINREPARAAFLPYADETSAIMDKY
ENSPWYFSLNGTWKFSWSQTPDERPKDFYKTDFSTLHWKDLQVPSNWELHGYGVPIYTNI
TYPFEKNPPFINHWDNPVGSYKRDFVLPENWKNRHVFLHFEAGTAAMYIWVNGEKVGYTE
NTKSPAEFDISKYLKPGKNNLAVEVYRWSDGSYLEDQDMWRLSGIDRNVYLYSTEDVRIS
DFFAKPDLDAKYKNGSLNVEVSLKNLTSKAINNQKLIAKLVDASGKNVFTKEINVNFEAS
KVQTINFAQNISSPKLWSSETPNLYTLLLTLKNQKGEIIETVSTQIGFRKVELKGGQLLV
NGVRLMVHGVNIHEHNPETGHYQDEATMMKDIKMMKQLNINSVRCSHYPNNILWVKLCNK
YGLFLVDEANIESHGMGVEGQPLKWMNPKTNPGYLPEWREAHLDRIYSLVERDKNMPSVI
IWSLGNESANGPVFHEAYKWIKKRDITRLVQFEQAKENENTDIVCPMYPTIEYMKEYAAR
KEVSRPYIMCEYSHAMGNSSGNFQEYWDIIRGSKNMQGGFIWDWVDQGFQGIDEAGRKYW
TYGGDMGSQNYLNDENFCHNGLVYPDRTPHPGAFEVKKVYQNILFKAVDIKNGVIEINND
FGFTNLNKYNFRYEVLENGKVIKEGTFNVVLDPKTKKQFKLDLPKLQSKAGTEYLLNVFA
HTKTGSELLPQNFEIAKEQFVIEDDKYFEKSEKVNTAKVQDEKDQFVLTSDNVTVKISKS
TGLISYYSLKGEEYFKQYPEPNFWRAPTDNDIGNKMQIRTNVWRTAGKNTSLESIQQTEE
NGQKYIVAKLKLSDVASDYTIKYALANDGALEIQASYKKGANPVPELPRFGMIFTLKNTL
ENLDYYGRGPLENYPDRKTSSLKGIYSSKVADQYVPYTRPQENGYKTDIRWFKLSGNSGN
GLEIKGLQPLAMSTLNNYPSDFDGGISKKNIHSSDITPRNEVVVCVDLTQRGLGGDNSWG
LPPHEQYVLTKSEYSYGFVIKPL
NT seq 3132 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaaaccaaaatattttttataagccttttactgcttttctcggcgggtatttgg
gctcaggaaaaagaccgcaacgattgggaaaatcctgaagtatttcaaattaacagagaa
ccagcccgcgctgcttttcttccttatgcagatgaaacttctgctataatggataaatat
gaaaattcgccttggtatttttctttaaacggtacatggaaattttcctggtcgcaaacg
ccagacgagcgcccgaaggatttttacaaaacagatttcagtacgctgcattggaaagat
cttcaagtgccttccaattgggaactgcatggttacggcgtgccaatttatactaatatc
acgtatccattcgaaaaaaatccgccttttatcaatcattgggataatcctgttggttct
tataaaagagattttgtactgccagaaaactggaaaaaccgacatgtttttcttcatttt
gaagcaggaacagcggcgatgtatatttgggtaaacggcgaaaaagttggttatacagaa
aataccaaaagtccggcagaatttgatatttctaaatatttaaaaccaggaaaaaacaat
ctggctgtagaagtgtacagatggagcgatggttcatatctggaagatcaggatatgtgg
agactttcaggaattgatagaaatgtgtatttgtatagtactgaagatgttcgtatttca
gacttttttgcaaaaccagatttagatgcgaagtataaaaatggaagtttaaatgtggaa
gtgagtttaaaaaatctgacttcaaaagcaataaacaatcaaaaattaattgcaaaatta
gttgatgcttcagggaaaaatgtatttactaaagaaatcaatgtcaattttgaagcatca
aaagttcagacaatcaattttgcccagaatatatcaagtccgaaattatggagcagtgaa
acaccgaatttatacactctgcttttgactttaaagaatcaaaaaggagaaattatagag
acggtttcaacgcaaatcggatttagaaaagtagaattaaaaggcggtcagttattggta
aacggagttagattgatggttcatggcgtaaatattcacgagcataatccagaaacggga
cattatcaggatgaagcaacgatgatgaaagacatcaaaatgatgaaacagctgaatatc
aattctgttcgctgcagtcattatcccaacaatattctatgggtaaaactttgtaataaa
tacggtttgtttttggtcgatgaagccaatatagaaagccacggaatgggagtagaggga
cagcctttaaaatggatgaatccaaaaacgaatccaggctatcttccagaatggagagaa
gcacatttggaccgaatttacagccttgttgaaagagataaaaatatgccgtctgtaatt
atctggtcattaggtaatgaaagtgctaacggaccggtttttcatgaagcatacaaatgg
attaaaaagagagacattaccagattggttcagtttgaacaggcaaaagaaaacgaaaac
acagatatcgtctgcccaatgtatccaacgattgaatacatgaaagaatatgcggcaaga
aaagaagtgagtcgcccgtatattatgtgtgagtattcgcatgctatggggaacagcagc
ggtaattttcaggaatactgggatatcattcgcggaagcaaaaatatgcagggcggtttt
atctgggactgggtagatcagggttttcaaggaattgacgaagcgggccgtaaatattgg
acgtatggcggtgatatgggaagccagaattatctaaacgatgaaaacttctgccacaac
ggattggtttatccagatagaacaccgcatcctggagcatttgaagtaaaaaaagtatat
cagaatattttgttcaaagcagttgatatcaaaaatggtgtaatcgaaattaataatgat
tttggatttacaaacctgaataaatacaatttcagatacgaagttttagagaacggaaaa
gtaattaaagaaggaacttttaatgttgttttagatccaaaaacgaaaaaacaattcaaa
cttgatttaccaaaattgcagtcaaaagcaggaacggaatatttactgaatgttttcgct
cacactaaaacaggatctgaattattgccacaaaacttcgaaatcgccaaagaacaattt
gtaatcgaagacgataagtatttcgaaaaatctgaaaaagtaaatactgcaaaagttcag
gacgagaaagatcagtttgttttgacttcggataatgttacggttaaaatcagcaagtca
actggattgatttcgtattacagtttaaaaggcgaagaatatttcaaacaatatcctgaa
cctaatttctggagagcgccaaccgataatgatattggaaataaaatgcagattagaacc
aatgtatggagaacggctggaaaaaatacctctttagaaagtattcagcagacagaagaa
aacggtcagaaatatatcgttgcaaaattaaaattaagcgatgttgcttcagattacacg
atcaaatatgcattggcaaatgatggagctttagaaattcaggcttcgtataaaaaaggt
gctaatcctgttcctgaactaccgcgttttggaatgattttcactttgaaaaatacatta
gagaatctggattattacggaagaggacctttagaaaattatccggacagaaaaacatca
tctttaaaaggaatttatagcagtaaagttgcagaccaatatgtgccttatacacgccct
caggaaaatggatacaagaccgatatacgctggttcaaattatcaggcaattcaggaaat
ggcttggaaataaaaggtctgcagcctttagctatgagtactttgaataattatccaagc
gattttgacggaggaatttcgaaaaagaatattcattccagtgatattacaccaagaaat
gaagttgtggtctgtgtcgacttaacgcaacgcggacttggcggcgataacagctgggga
ttaccgccgcatgaacagtatgtattaacaaagagtgaatacagctatggatttgtcatt
aaaccactttaa

DBGET integrated database retrieval system