KEGG   Flavobacterium johnsoniae: Fjoh_3340Help
Entry
Fjoh_3340         CDS       T00508                                 

Definition
cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
fjo  Flavobacterium johnsoniae
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3994229..3995338
Genome map
AA seq 369 aa AA seqDB search
MSLTAYKSVEQPDYIDIQELRKIYSGGDPSKWPAAELHESVDKSKFQDIGVLPAVPYPAY
NPYSKEKESLGKILFFDPRLSRSGQIACASCHNPELGWTDNLTRSFGHDRQTGKRNSMTI
LNSAYATSLFWDGRASSLEDQAQFPVSDPLEMNEKLTIAVDKIAKIKGYNSLFTAAFGDK
KVTLERIQYAIATFERSINSPKSKFDQFVSGKSDIYTDQQVKGMHLFRTKAQCINCHNTP
YFSDNEFHNDGQTLFGTKNEDFGRYNVTKDVKDIGKFRTPTLREVVNTKPWMHHGHFPTL
LDVVELYNLGNPSPVQKKYLGTARDSLIPKSDPMLRKLDLSKEEISDLLAFIETLSTPTR
RIMVPEMPK
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
gtgagtttgacggcttataaaagcgttgaacagcccgattatatcgacatacaggaatta
cgaaaaatttattccggcggagatccttcaaaatggcccgctgcagaattacacgaaagt
gtagataaatcgaaatttcaggatattggcgttttgcctgctgttccttatcctgcatat
aatccgtattcgaaggaaaaagaaagtttgggcaagattttgttttttgatccgagattg
tcgcgaagcggacaaattgcgtgtgcttcttgccacaatccagaattgggctggacagat
aatctaacacgctcttttggtcatgatcgccaaactggaaaacgcaattctatgacgatt
ttaaattcggcatacgcaacctctctattttgggacggacgagcttcgagcttagaagat
caagcgcaatttcctgtttctgatcctttagaaatgaacgaaaaactgacgattgccgtt
gataaaattgccaaaattaaaggttacaattctctttttacagcagcttttggagataaa
aaagtaactttagagagaattcaatatgcgattgctactttcgaaagatctattaatagt
ccgaaaagtaaatttgaccagtttgtaagcggaaaatcagatatttatactgatcagcag
gtaaaaggaatgcatttgttcagaaccaaagcgcaatgcatcaactgccataatacgcct
tatttcagcgataatgagtttcataatgacggacagactttatttggtacaaaaaatgaa
gatttcggacgctataatgtgacgaaagatgtaaaagatatcggcaaatttagaacgcca
acactccgtgaagtcgtaaatacaaaaccatggatgcatcacggacattttccaacttta
ttggatgttgtcgaattgtacaatctcggaaatccgtctcctgttcaaaaaaaatatcta
ggaacagcccgagattctttaattccaaaatcagatccaatgcttagaaagttagatttg
agcaaagaagaaatcagcgatctattagcttttatcgaaactttaagcactccgacaaga
agaattatggttccagaaatgcccaaataa

DBGET integrated database retrieval system