KEGG   Flavobacterium johnsoniae: Fjoh_3378Help
Entry
Fjoh_3378         CDS       T00508                                 

Definition
glycoside hydrolase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
fjo  Flavobacterium johnsoniae
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:fjo00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:fjo00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:fjo00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4036124..4038943)
Genome map
AA seq 939 aa AA seqDB search
MKIFYVKRIFLCILFLVSVLALAQNKSERELILIDNDWRFSFGHLYDTEKDFKHAEGYFS
YLTKTGFGDGPAAKDFDDRAWRKLDLPHDWAVEQEFSESGSFSHGFKTSGKGFPEKSIGW
YRKKITIPETDKGKIISIKFDGVFRNSKVFFNGYYLGTEQSGYNGFEYDVSAYVNYGGEN
TIVVRADASMEEGWFYEGAGIYRHVYLQKTNPIHVAANGTYITSEITNTTAEITAEVSIE
NKGNYKGSVEIIQTVFDASNQQIAGVSENVNAPEFYKTDKYTSKLQVNNPLLWDIDSPNL
YRLVTQIKQNEKIIDNYETSFGIRTIKFDSEKGFFLNGKPVKLKGTNNHQDHAGIGTALP
DEIQYYRIKKLKEMGSNAYRCSHHPPTPELLKACDELGMLVINETRLMGINDYHLNDLKR
MMERDRNHPSIFCWSVGNEEWNIEGNIVGERVTNVMQDFAKSIDPTRPVTVGISSGFKSG
ISSVVEIMGYNYLGNGDIDAHRNQFKNQPGMGTEEGSTFATRGIYFTDDAKHYQSAYDRK
PRPTFYSIEEGWKFYAERPYLAGMFIWTGFDYRGEPTPYGWPSVTSYFGMMDVCGFPKDN
VFYLKSWWGTQPVLHIMPHWNWSGMEGKEMDVWVHSNCDEVQLFLNKKSLGKKKMELNSH
LEWKVKYMPGTLEAIGYKNGKKVLTEIQKTTEKAQNIKLSIDKENIPNSKVLVVTAEVTD
KNGLHIPTSNEEITFSIKGGKILGVGNGDPASLEKDQFIDAVSLVQITNFQEQKGLTADL
PQEFQNYPENDWKTAFRDRDYKNQAPSYVYKGEFDLKNNSALNKVSFFYKKIGVEAVVFI
NGNKINPSSEDSQKYILDSSILKEGKNTIHIAATPLQKIKDWDVLNIDPGIIQVITPAES
WKRKLFNGYAQIIIQKEESADEVVLSAFAKGLKTGILKK
NT seq 2820 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattttttacgtaaaaagaatttttctgtgtatcctatttttggtttccgttctg
gctttggcccaaaacaaatcagaaagggaattgatattgattgataacgactggcgtttt
tcatttggtcatttatatgatacagaaaaagattttaaacatgcagaaggctatttttca
tatttaaccaaaaccggatttggcgacggcccggcggcaaaagattttgatgaccgcgcg
tggcgaaaattagatctgcctcacgattgggctgttgaacaagagtttagtgaaagcggc
agtttcagccacggatttaaaacgtctggaaaaggttttccggagaaaagcattggttgg
taccgaaaaaaaatcactattcctgaaaccgataagggcaaaattatttcaataaaattt
gatggtgtttttagaaattcgaaagttttttttaacggctattatctgggaacagaacaa
agcggatacaatggttttgaatatgatgtatcagcttatgtaaattatggaggcgaaaat
acgattgtagttcgtgccgatgcttcgatggaagaaggctggttttatgaaggagccgga
atttacagacatgtttatctgcagaaaacaaacccaattcatgttgccgcaaacggaact
tatataacctcagaaattacaaatactactgccgaaataactgccgaagtttctattgaa
aacaaaggaaattataaaggttctgttgaaattattcagactgtttttgatgcttcaaac
caacagattgcaggtgtatctgaaaatgtaaatgctccggaattttataaaacagacaag
tatacttcaaaattacaagtaaataacccgcttttgtgggatattgattctccaaatctg
tatcgtttagtaactcagattaagcaaaacgaaaaaataatcgacaattatgaaacgtct
tttggaatcagaaccattaagtttgattcggaaaaaggattttttttaaacggaaaacct
gtaaaattaaaaggaaccaacaatcatcaggatcatgcgggaattggaacagcgcttcca
gatgaaattcagtattaccgaattaaaaagttaaaagaaatgggttcgaatgcgtatcgc
tgttcgcatcatccgccaacaccagaactgctgaaagcttgtgatgaacttggaatgctg
gtaattaatgaaacacgtttaatgggaattaacgactatcatttgaatgatttaaaacga
atgatggagcgcgaccgaaaccatccgagtattttttgctggtcggttggaaatgaagaa
tggaatattgaaggcaatattgtgggcgaacgcgtgacgaatgtaatgcaggattttgca
aaaagcatcgatccgacaagacctgtaactgttggaatcagcagcggatttaaaagcggc
atttcgtctgtagtagaaatcatggggtataattatcttggtaacggcgatattgatgcg
catagaaatcagtttaaaaaccaacccggaatgggaactgaagaaggttcgacttttgca
acacgcggtatttattttacagatgatgccaaacattaccaaagtgcttatgatcgcaaa
ccgcgtcccactttttacagtattgaagaaggctggaagttttatgccgaaagaccgtat
ctggccggaatgtttatttggacaggttttgattatcgcggagaaccaactccgtatggc
tggccttcggtaacttcatatttcggaatgatggatgtatgcggtttcccaaaagacaat
gtgttttatttaaaatcgtggtggggaacgcagccagttctgcatattatgccgcactgg
aactggagcggcatggaaggaaaagaaatggatgtatgggtgcattcgaattgcgatgaa
gtacaactttttctaaataagaaaagtctcggcaagaagaaaatggagctaaacagccat
ttagaatggaaagtaaaatatatgcccggaactctggaagccattggatacaaaaacggc
aaaaaagtattaacagaaatccagaaaacgaccgaaaaggctcaaaacataaaactatct
atagataaagaaaacattccaaattctaaagttttggttgtaacggcagaagttaccgat
aaaaacggattgcatattccaacttcaaatgaggaaattaccttttctataaaaggagga
aagattttaggagtaggaaacggcgacccggcttctttagaaaaagaccagtttatcgat
gctgtttcgttagttcaaataacgaattttcaggagcaaaaaggattgacggctgatttg
cctcaggaatttcaaaattatcctgaaaatgattggaaaacagcctttagagaccgtgat
tataaaaatcaggcaccgtcttatgtttataaaggagaatttgacttaaaaaataattca
gctttaaataaggtgagcttcttttataaaaaaataggagtggaggcagtagttttcatc
aacggaaataaaataaatccaagttcagaagattctcaaaaatatattttagactccagt
attttaaaagaaggaaaaaacacgattcatattgcagcaacgcctttgcaaaaaataaaa
gactgggacgtgctgaatatagatcccggaattatacaagttataacacccgcagaatcc
tggaaaagaaaactttttaatggttatgcgcaaatcataattcaaaaagaagaaagtgca
gatgaagttgttttatcggctttcgccaaaggattaaaaacaggaattttgaagaaatag

DBGET integrated database retrieval system