KEGG   Flavobacterium johnsoniae UW101: Fjoh_3431Help
Entry
Fjoh_3431         CDS       T00508                                 

Definition
(GenBank) Glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
fjo  Flavobacterium johnsoniae UW101
Pathway
fjo00330  Arginine and proline metabolism
fjo00332  Carbapenem biosynthesis
fjo01100  Metabolic pathways
fjo01130  Biosynthesis of antibiotics
fjo01230  Biosynthesis of amino acids
Module
fjo_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:fjo00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Fjoh_3431
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Fjoh_3431
Enzymes [BR:fjo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Fjoh_3431
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase DOT1 Phos_pyr_kin
Motif
Other DBs
NCBI-ProteinID: ABQ06445
JGI: Fjoh3431
UniProt: A5FEC3
Position
complement(4098466..4099227)
Genome map
AA seq 253 aa AA seqDB search
MGKKRILLKIGSNTLTKETNHISRGKIEDLGIQIAALNDEYEFIIVSSGAIAAAKQFVKL
DNQDKDVFVKQALASIGQPHLMRIYNENFKDLGLNTSQCLLSYSDFEKEQTKKNIVNTIN
VLVKNNYIPIINENDTVATDEIRFGDNDKLAALTAVLLNVDILIIATNTNGIYTKNSIHD
ENPETIKLVNDLKSLEKEIGESKSSHGTGGMQSKIEAAGISKAANIETWIVNGLNDNFIL
KALKDEIPFTKIV
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgggtaagaaacggattttattaaaaataggaagtaatactttaaccaaagaaaccaat
catatttcgcggggaaagattgaagacctcggaatacagattgctgctttaaatgacgaa
tatgagtttatcatagttagttcaggagcaattgcagcagcaaagcagtttgtgaaactt
gataatcaggataaagatgtttttgtaaaacaggctttggcttcaattggacagcctcat
ttaatgcggatttacaatgaaaattttaaggatttaggattaaatacttctcagtgtttg
ctttcttattctgattttgaaaaagaacagactaaaaagaacattgtaaatacaattaat
gtattagttaaaaacaattatattccgattatcaatgaaaatgataccgttgccacagat
gagattcggtttggagataatgataaattagcggctttaacagcagttcttttaaatgtt
gatattctgataattgccactaatacaaacggaatttacacaaagaattcaattcatgat
gaaaatccggagacgataaaattggtaaatgatttaaaatcactcgaaaaagaaatcggc
gaatcaaaatcatcacacggaacaggaggaatgcaatctaaaatagaagcagcaggaatt
tcaaaagctgccaacattgaaacctggattgtcaatggactgaatgataattttatttta
aaggcactcaaggacgaaattccttttaccaagattgtgtaa

DBGET integrated database retrieval system