KEGG   Flavobacterium johnsoniae UW101: Fjoh_3446Help
Entry
Fjoh_3446         CDS       T00508                                 

Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
fjo  Flavobacterium johnsoniae UW101
Brite
Enzymes [BR:fjo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Fjoh_3446
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT RrnaAD Methyltransf_31 Methyltransf_32 Methyltransf_11 Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: ABQ06460
JGI: Fjoh3446
UniProt: A5FEA5
Position
complement(4113295..4113936)
Genome map
AA seq 213 aa AA seqDB search
MKDTAKHQGLRNQLVTTLEQKGITDRAVLDAIKKIPRHLFLNSSFEDFAYQDKAFPIGAG
QTISQPYTVAFQSQLLEVKKDHKILEIGTGSGYQTAVLFMLGAKVYTVERQSELFKTTSN
LFPKLNIRPKHVTFGDGYKGLPNFAPFDSIIVTAGAPFIPQPLMAQLKIGGRLVIPLGED
VQIMTLLIRKNETQFEKHEFGEFRFVPLLEDKN
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagacactgccaaacatcaaggacttcgtaatcaattagtaaccactttagagcaa
aaaggaattactgacagagctgttttagatgcgataaaaaaaatcccaagacaccttttt
ttgaattctagttttgaagattttgcttatcaggacaaagcgtttcctattggtgccggg
cagactatttctcagccttacacggttgcttttcagtcacaattacttgaagttaagaag
gatcacaaaatcctggaaataggaacaggttctggttatcaaactgccgttttatttatg
cttggtgctaaagtatatacggtagagagacaaagtgaactatttaaaacaacatctaat
ttatttccgaaattaaatatccgtcctaaacacgttacgtttggagatggttataaagga
ttgccaaattttgcaccatttgacagtattatagttacagctggtgcgccatttattccg
cagccattaatggcacaattaaaaataggaggaaggcttgttattccgttaggggaagat
gttcagattatgactttattgattagaaagaacgaaactcaatttgaaaaacatgagttt
ggagaatttagatttgttcctctattagaagataaaaattaa

DBGET integrated database retrieval system