KEGG   Flavobacterium johnsoniae: Fjoh_3504Help
Entry
Fjoh_3504         CDS       T00508                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
fjo  Flavobacterium johnsoniae
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:fjo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Fjoh_3504 (tpiA)
   01230 Biosynthesis of amino acids
    Fjoh_3504 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Fjoh_3504 (tpiA)
   00051 Fructose and mannose metabolism
    Fjoh_3504 (tpiA)
   00562 Inositol phosphate metabolism
    Fjoh_3504 (tpiA)
Enzymes [BR:fjo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Fjoh_3504 (tpiA)
Exosome [BR:fjo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Fjoh_3504 (tpiA)
  Exosomal proteins of bladder cancer cells
   Fjoh_3504 (tpiA)
  Exosomal proteins of melanoma cells
   Fjoh_3504 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4178433..4179185
Genome map
AA seq 250 aa AA seqDB search
MRKSIVAGNWKMHKNAAQTEELLNELIAKIPAKTNAQVIVAPTFVNLQAAAAKLKNTTIG
VSAQNVHQAEGGAFTGEISADMLTSIGVNTVILGHSERRAIFHETDALIANKVDTALKHD
MTVIFCFGEELKDRQSGNHFNIVENQLRDGVFHIAKESWSKIVLAYEPVWAIGTGETASP
EQAQEMHEFIRETIRKAFGAEIADEVSILYGGSVKPENAKEIFSKPDVDGGLIGGAALKA
DDFLAIVTAI
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaatcgattgttgcaggaaactggaaaatgcataaaaatgcagcgcagactgaa
gaattattaaacgaattaattgcaaaaattccagcaaaaacaaatgcacaagttattgta
gcgccaacttttgtaaacttacaagctgctgctgctaaattaaaaaatacaactattgga
gtttctgctcaaaacgttcaccaagctgaaggcggtgcttttacaggagaaatttctgca
gatatgttaacaagcattggtgttaatactgtaatcttaggtcactctgagcgtagagct
attttccacgaaactgatgctttaatcgcaaacaaagttgatactgctttaaaacacgat
atgacagtaattttctgttttggagaagaattaaaagaccgtcagtctggaaatcatttc
aacattgttgaaaatcaattacgtgacggagttttccatatcgcaaaagaatcttggtct
aaaattgttttagcttacgaaccagtttgggctatcggaactggagaaactgcttcacca
gaacaagctcaggaaatgcacgaatttatcagagaaacgatccgcaaagcttttggagct
gaaatcgcagatgaagtttctattttatacggtggttctgtaaaaccagaaaacgctaaa
gaaatcttctctaaaccagacgtagatggtggtttaattggtggtgcagctttaaaagct
gacgatttcttagcaattgtaactgctatctaa

DBGET integrated database retrieval system