KEGG   Flavobacterium johnsoniae UW101: Fjoh_3504Help
Entry
Fjoh_3504         CDS       T00508                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
fjo  Flavobacterium johnsoniae UW101
Pathway
fjo00010  Glycolysis / Gluconeogenesis
fjo00051  Fructose and mannose metabolism
fjo00562  Inositol phosphate metabolism
fjo01100  Metabolic pathways
fjo01110  Biosynthesis of secondary metabolites
fjo01120  Microbial metabolism in diverse environments
fjo01130  Biosynthesis of antibiotics
fjo01200  Carbon metabolism
fjo01230  Biosynthesis of amino acids
Module
fjo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
fjo_M00002  Glycolysis, core module involving three-carbon compounds
fjo_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:fjo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Fjoh_3504
   00051 Fructose and mannose metabolism
    Fjoh_3504
   00562 Inositol phosphate metabolism
    Fjoh_3504
Enzymes [BR:fjo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Fjoh_3504
Exosome [BR:fjo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Fjoh_3504
  Exosomal proteins of bladder cancer cells
   Fjoh_3504
  Exosomal proteins of melanoma cells
   Fjoh_3504
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM Flavi_DEAD
Motif
Other DBs
NCBI-ProteinID: ABQ06518
JGI: Fjoh3504
UniProt: A5FE44
Position
4178433..4179185
Genome map
AA seq 250 aa AA seqDB search
MRKSIVAGNWKMHKNAAQTEELLNELIAKIPAKTNAQVIVAPTFVNLQAAAAKLKNTTIG
VSAQNVHQAEGGAFTGEISADMLTSIGVNTVILGHSERRAIFHETDALIANKVDTALKHD
MTVIFCFGEELKDRQSGNHFNIVENQLRDGVFHIAKESWSKIVLAYEPVWAIGTGETASP
EQAQEMHEFIRETIRKAFGAEIADEVSILYGGSVKPENAKEIFSKPDVDGGLIGGAALKA
DDFLAIVTAI
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaatcgattgttgcaggaaactggaaaatgcataaaaatgcagcgcagactgaa
gaattattaaacgaattaattgcaaaaattccagcaaaaacaaatgcacaagttattgta
gcgccaacttttgtaaacttacaagctgctgctgctaaattaaaaaatacaactattgga
gtttctgctcaaaacgttcaccaagctgaaggcggtgcttttacaggagaaatttctgca
gatatgttaacaagcattggtgttaatactgtaatcttaggtcactctgagcgtagagct
attttccacgaaactgatgctttaatcgcaaacaaagttgatactgctttaaaacacgat
atgacagtaattttctgttttggagaagaattaaaagaccgtcagtctggaaatcatttc
aacattgttgaaaatcaattacgtgacggagttttccatatcgcaaaagaatcttggtct
aaaattgttttagcttacgaaccagtttgggctatcggaactggagaaactgcttcacca
gaacaagctcaggaaatgcacgaatttatcagagaaacgatccgcaaagcttttggagct
gaaatcgcagatgaagtttctattttatacggtggttctgtaaaaccagaaaacgctaaa
gaaatcttctctaaaccagacgtagatggtggtttaattggtggtgcagctttaaaagct
gacgatttcttagcaattgtaactgctatctaa

DBGET integrated database retrieval system