KEGG   Flavobacterium johnsoniae: Fjoh_4336Help
Entry
Fjoh_4336         CDS       T00508                                 

Definition
Mg-chelatase subunit ChlI-like protein
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
fjo  Flavobacterium johnsoniae
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:fjo00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5241316..5242779)
Genome map
AA seq 487 aa AA seqDB search
MEINNIKTLGQLKAAGYKSTGIKDELRNNLREKIKTGKPVFEGVHGFENTVIPELERAIL
SRHNINLLGLRGQAKTRLARKMVELLDEYIPFVTGSEINDDPLNPISRFAKDLIEEKGDE
TPISWLHRSERFFEKLATPDVTVADLIGDVDPIKAANLKLSYADDRVIHFGMIPRANRCI
FVINELPDLQARIQVALFNILQEGDIQIRGFKLRMPLDMQFIFTANPEDYTNRGSIVTPL
KDRIGSQILTHYPETVEIARTITQQEAKLDQNQSDIVYVPSLARDILEQISFEARESEYI
DNKSGVSARMSITAFENLISSAERRALKSGVDKTNLRLSDFMGIIPAITGKVELVYEGEQ
EGAAVVAQHLIGSAIRTLFPSLFPKIEKLEKPGEKTPYSDLIEWFFAESGFELLDDASDA
EYQSILDEVTPLDLLLKKYHPELDKKDQYFMKEFVLWALVEYKKLSKDRFAQGHQFKDMY
GSYISKL
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggaaataaacaatataaaaacattagggcagttaaaagctgcaggatataaaagcaca
ggtataaaggacgaattacgaaataatcttcgtgagaaaatcaaaaccggaaaaccagtt
tttgaaggtgttcacggatttgaaaatacggtaatcccagaattagaacgtgcaattctt
tctcgtcataatatcaatttacttggacttcgcggacaagcaaaaacacgtttggcacgt
aaaatggtcgaattattagatgaatacattccgtttgtaacaggttcagaaatcaatgat
gatccgctgaatccaatttcgcgttttgcaaaagatctaattgaagagaaaggagatgaa
actccaatttcgtggctgcacagaagcgaacgtttcttcgaaaaattagcaactccagat
gttacagttgctgatttaattggtgatgttgacccaattaaagcagcaaatttaaaatta
tcatacgcagatgaccgcgtaattcatttcggaatgattccgagagcaaaccgctgtatt
tttgtaatcaacgaattacctgatttacaagccagaattcaggttgcattattcaatatt
ctgcaggaaggagatattcaaattcgtggttttaaattgagaatgcctcttgatatgcag
tttatttttaccgcaaatccagaagattataccaatagaggaagtattgtaacaccttta
aaagacagaataggttcgcagattttaacgcattatcctgaaaccgtagaaattgcaaga
accattacacagcaggaagctaaactggatcaaaaccaaagcgatatagtgtatgtgccg
agtttagccagagatattttagaacaaattagttttgaagcacgcgaaagcgaatacatc
gacaataaaagcggtgtaagtgccagaatgagtattacggcttttgaaaacctgatcagc
agtgcagaacgccgagctttaaaatccggagtagataaaaccaatctgcgtttatcagat
tttatgggaatcattccagctattaccggaaaagtagaattggtttatgaaggagagcag
gagggagcagctgttgtagcacagcatttaattggttcagcaattcgaactttgtttcca
tccttatttccgaaaattgagaaactagaaaaaccgggagaaaaaacaccatattctgat
ttgatcgaatggttttttgcagaaagcggtttcgaattattagacgatgcttctgatgcg
gaataccaaagtattttagatgaagtaacacctttagatcttttactgaaaaaataccat
cctgaattagataaaaaggatcagtatttcatgaaagaatttgttttatgggcattggta
gaatataaaaaactgagtaaagatcgttttgcacaaggacatcagtttaaagatatgtac
ggaagttatatcagcaaactttaa

DBGET integrated database retrieval system