KEGG   Flavobacterium johnsoniae: Fjoh_4556Help
Entry
Fjoh_4556         CDS       T00508                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
fjo  Flavobacterium johnsoniae
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fjo00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Fjoh_4556
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Fjoh_4556
Enzymes [BR:fjo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Fjoh_4556
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5504408..5506474)
Genome map
AA seq 688 aa AA seqDB search
MKYLFVLLLAGVTANAQMQKEQLNLMPWPQNVVVNDGNFTLTKNFKVNISGNPDSRIFGG
VTRFLRRLDGRTGIFFEQGFITKLNEFPNAELQINCTKNGKIGLYEDESYSLDVKANKIT
INATSDLGALHGLETLLQLLQNDSKKFYFPVSQISDFPRFTWRGLMLDASRHFQPVDVVK
RNLDALAAMKMNVFHWHLVDDQGWRIETKKHPKLIELASDGLYYTQEEIRNIVKYADERG
ILIVPEIDVPGHGSAILTAYPEIGSKVITLTGGTSEKNIQGTAISTYRIERNAGIFSPTL
DPSNPKTYKILSELFDEVCPLFPGAYFHIGGDENEGKDWDANPKIQEFKKKHNLKTNHEL
QTYFTMQLAPMLKKHGKQLMGWEEILTKDLSKEAIVHSWRGPNEGMVAGQSLVDAVKKGY
KTVLSNGFYIDLMYPVASHYLNDPMPKGADLSAEEKARILGGEATMWTELATPETFDSRV
WPRTAAIAERLWSAENITDVANMRKRLESVSFRLEELGLTHIKNKAVILRNIANNQNIKS
VNEFTNVCEPLKGYTRNKGGTEYQMYSPFTLFADACTPDAKDSLAFDEAVSQYLANKSAD
NKAKVAAFFNKWIAVNKGLVELSANAPLVQPILPLSKKLSDASQELLLVLDNKSTLKTAD
LKTLIEQCNTKDHADVELSVYESLKKLI
NT seq 2067 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatctatttgtactactattagcaggtgtaacggcaaatgctcaaatgcaaaaa
gaacagctgaaccttatgccctggcctcaaaatgttgtcgtaaacgacggaaattttaca
ttaactaaaaactttaaagtaaatatttctggaaatcctgattcaaggatttttggagga
gtaactcgttttttacgccgattagatggtagaacaggtattttttttgaacaaggtttt
attaccaaacttaatgagtttccaaatgcagaattacagattaactgtactaaaaatgga
aaaataggtttatatgaagatgaaagctacagcttagatgttaaagcaaacaaaattaca
attaatgcaaccagcgatttaggagctttacatggactggaaacgttattgcagctgctt
caaaacgacagcaaaaaattctatttccctgtttctcaaatctcagactttccaagattt
acctggagaggtttaatgcttgatgcttcgagacattttcagccggtagatgtagtgaaa
agaaatctggatgcattggcagcaatgaaaatgaatgttttccactggcatttagtagac
gatcaaggctggagaattgaaactaaaaaacatccaaaactaatagaactggcttcggat
ggattatattacacacaagaggaaattagaaatatcgtaaaatatgccgatgagcgcggt
attttaattgttccggaaatagacgttccgggtcatggatctgcaatacttactgcttac
cctgaaattggaagcaaagtgattacattgaccggaggaacttctgaaaaaaatattcaa
ggtacggcaatctctacctatagaattgaaagaaatgcaggtatattttcgcctacatta
gatccttcaaatcctaaaacgtataaaatattaagtgaactttttgatgaggtatgcccg
ttatttcccggagcttattttcacattgggggtgacgaaaatgaagggaaagactgggat
gccaatccaaaaatccaggagttcaagaaaaaacataatttaaaaaccaaccatgaactg
cagacttattttactatgcagttagccccaatgcttaaaaaacatggaaaacaattaatg
ggctgggaagaaattttaaccaaagatctttctaaagaagcaattgtacattcgtggaga
ggtccaaatgaaggaatggttgcagggcagtcattagttgatgcagttaaaaaaggatat
aaaacagtattatcaaacggattttatattgatttaatgtatccagtagcaagtcattat
ttaaatgatcctatgccaaaaggagccgatttatctgcagaagaaaaagcaagaattttg
ggtggagaagctacaatgtggacagaacttgccacgccggaaacatttgattcaagagtt
tggccaagaacagcagcaattgcagaaagattatggtctgctgagaatattacagatgtt
gctaatatgcgtaaacgtcttgaaagcgtatcatttagattagaagaattaggattaaca
catattaaaaacaaagccgtaattcttagaaatattgcgaataaccagaatattaaatct
gttaatgaatttacaaatgtttgtgaaccattaaaaggatatacaagaaataaaggagga
actgaatatcaaatgtattctccgtttacactttttgcagatgcctgtactccggatgca
aaagattctctggcttttgatgaagccgtgagccaatatctggcaaataaatcagcagat
aacaaagcaaaagtggcagcatttttcaataaatggattgcagttaataaaggattagtt
gaattaagtgccaatgcgcctttagtacagccaattctgcctttatctaaaaaattaagc
gacgcatcgcaagaattgctgcttgtattagataataaatcgactttaaaaacagccgat
ttaaaaaccttaatagaacaatgtaatacaaaagatcatgctgacgtagagttgtcagtt
tatgaaagtttaaagaaactaatttag

DBGET integrated database retrieval system