KEGG   Flavobacterium johnsoniae UW101: Fjoh_4591Help
Entry
Fjoh_4591         CDS       T00508                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
fjo  Flavobacterium johnsoniae UW101
Pathway
fjo00010  Glycolysis / Gluconeogenesis
fjo00030  Pentose phosphate pathway
fjo00051  Fructose and mannose metabolism
fjo00052  Galactose metabolism
fjo00680  Methane metabolism
fjo01100  Metabolic pathways
fjo01110  Biosynthesis of secondary metabolites
fjo01120  Microbial metabolism in diverse environments
fjo01130  Biosynthesis of antibiotics
fjo01200  Carbon metabolism
fjo01230  Biosynthesis of amino acids
fjo03018  RNA degradation
Module
fjo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:fjo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Fjoh_4591
   00030 Pentose phosphate pathway
    Fjoh_4591
   00051 Fructose and mannose metabolism
    Fjoh_4591
   00052 Galactose metabolism
    Fjoh_4591
  Energy metabolism
   00680 Methane metabolism
    Fjoh_4591
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Fjoh_4591
Enzymes [BR:fjo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Fjoh_4591
Protein phosphatases and associated proteins [BR:fjo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Fjoh_4591
Messenger RNA biogenesis [BR:fjo03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Fjoh_4591
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ABQ07590
JGI: Fjoh4591
UniProt: A5FB25
Position
complement(5550890..5551876)
Genome map
AA seq 328 aa AA seqDB search
MSKTIKKVGVLTSGGDSPGMNAAIRSVVRTCAYHNIECIGIYRGYQGMIEGDFKEMGPRS
VNNIVNKGGTILKSARSVDFRTPEGRKKAHENLLKAGIDALVVIGGDGSFTGGLIFNSEY
DFPVMGIPGTIDNDIYGTSFTLGYDTALNTVVDCIDKIRDTASSHNRLFFVEVMGRDAGH
IALNAGIGAGAEEILIPEEDLGLDRLLDSLQKSKASGKSSSIVVIAEGDKIGKNVFELKD
YVEANLPEYDVRVSVLGHMQRGGSPSCFDRVLASRLGVKAVESLIEGKSNYMVGLKEDKV
VLTPLEQAIKGKSEIDRELLRVSDIMST
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaacaataaaaaaagtaggtgttcttacctcaggaggagactcaccgggaatg
aatgctgcaatacgatcagttgttcgaacatgtgcttatcataatatagaatgcatagga
atttatagagggtatcaaggaatgatcgaaggtgattttaaagaaatgggccctcgaagc
gttaataatattgtaaataaaggaggaacgatcctgaaatcggctcgttctgtagacttt
agaaccccggaaggccgtaaaaaagctcacgaaaatcttcttaaagccggaattgatgct
ttagttgttattggaggagacggaagttttaccggaggtttaatttttaactcagaatat
gattttcctgtaatgggaattccaggtacaattgataatgatatttatggtacaagcttt
actttaggttatgacactgctttaaatactgttgttgactgtatagataaaattagagat
actgcaagttcacataaccgtttattctttgtagaggttatgggtagagatgcaggtcac
atcgcacttaatgccggaattggagcaggtgcagaagaaatccttattcctgaagaagat
ttaggtcttgacagattgttagactctcttcaaaaaagtaaagcttcaggaaaatcatca
agtatagtagttattgccgaaggtgataaaattggtaaaaacgtattcgaattaaaagat
tatgttgaagctaatttacctgaatacgacgtaagagtatctgttttaggacacatgcag
cgtggtggttcgccatcttgttttgaccgtgttctggcaagtcgtcttggtgtaaaagca
gttgagtctttaattgaaggaaaatcaaactacatggttggtcttaaggaagataaagtt
gttttaactccgctggagcaggcaattaaaggtaaatctgaaattgatagagaattattg
agagtgtcagacattatgtctacataa

DBGET integrated database retrieval system