KEGG   Flavobacterium johnsoniae: Fjoh_4607Help
Entry
Fjoh_4607         CDS       T00508                                 

Definition
Outer membrane phospholipase A-like protein
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
fjo  Flavobacterium johnsoniae
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:fjo00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:fjo00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:fjo00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:fjo00591]
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:fjo00592]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5571192..5572013)
Genome map
AA seq 273 aa AA seqDB search
MYLKYILACVVLLTIKANSQIVEDKKNFRAADSLLKEHSFSVHKDNYFLTGIPLDEDITR
NTADVKYQVSFKLRLNSKPLWGGFFPYLMYTQKAFWDIYANSKPFSEINFNPGVAIVRPF
YLKGGRLTYGTISLEHESNGRDSIYSRTWNMLAFSLKSQVSPRWTVGLRGWIPLVDKEDN
PGLTKYVGYGEASATYQIQPGRWSADVLFRKGSGLINYGSLQTQLNWRPYKDENYYLTLQ
WFVGYTESLIDYQEHKSMIRLGFTIKPENMGIF
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgtacttaaaatatatactagcatgcgttgttttgttaacaattaaagcaaattcacaa
attgtagaagataaaaaaaatttccgtgcagcagattcgctgctcaaagaacatagtttt
tctgtccataaggataattattttttaaccggaattcctctagatgaagatattacgcgt
aacacagccgatgtcaaatatcaggttagttttaaactccgattaaactcaaaacctttg
tggggcggttttttcccttatttaatgtatactcaaaaggctttttgggatatttatgca
aattcaaaacccttttcagaaattaactttaatcccggagtagcaattgttcgtccgttt
tatttaaaaggaggaaggctgacctatggaaccatttcattagaacatgaatcaaacgga
agagattctatttactccagaacctggaatatgcttgctttttcgttaaaatctcaggtt
tcgccgcgatggactgttggacttagaggatggattccgcttgttgacaaagaagacaat
cccggacttacaaaatatgtaggctacggcgaagcaagcgcaacttaccagatacaaccc
ggaagatggagtgcagatgttctttttagaaaaggaagcggtcttatcaattacggttct
ttacaaacacaattaaactggagaccttataaagatgaaaattattatctcaccttgcaa
tggtttgtgggatataccgaaagtttaattgactatcaggaacacaaaagcatgatacgt
cttgggtttactataaaaccagaaaatatgggaattttttaa

DBGET integrated database retrieval system