KEGG   Flavobacterium johnsoniae: Fjoh_4687Help
Entry
Fjoh_4687         CDS       T00508                                 

Definition
arginase/agmatinase/formiminoglutamase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
fjo  Flavobacterium johnsoniae
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:fjo01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:fjo00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5667378..5668280
Genome map
AA seq 300 aa AA seqDB search
MKEITIVEFTSNLGLKEPQTGKEPGVNRLPDWLWKHNLHKAITPKNIVRLDPPRYSNIKD
PQTTILNADSLVTYAREQAYLINNLISANKFPFVLGGDCSILLGTAMALKQKGNYGLFYL
DGHTDFMDVSLSETGGTGGMIASIVTGNGHEKLTNILNLSPYIKEENLWCVGNREYDDEY
ENEIRKSSAVYLSLKELRKQGIKNSVQSFLLEVESKKLDGFWLHIDVDVLNDSVMPCVDS
RTPDGLTYDEFNELTSYLFQSQKLSGLEITILDPDLDQTGEYTKEFVANITSTFNQNFNN
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaataactattgtcgaattcacttctaatttgggcttaaaagaacctcaaacc
ggaaaagaaccaggcgtaaaccgtctgcccgattggttatggaaacacaatcttcataaa
gccattacaccaaaaaatatcgtaagacttgatccgcccagatattcaaacataaaagat
cctcaaactactattttaaatgcagactcattagttacttatgccagagaacaggcttat
ttgataaacaatttaatcagcgccaataaatttccttttgtacttggcggtgactgcagt
atacttttaggaaccgcaatggcattaaagcaaaaaggaaattacggtctattctatctc
gacggtcatactgattttatggatgtttctttatctgaaaccggcggtacaggcggcatg
attgcgtctattgttactggaaacggacacgaaaaattaaccaatattcttaacttgtct
ccatacataaaagaagaaaacctttggtgcgtgggcaatcgcgaatatgatgacgaatac
gaaaatgaaatcagaaaatcttctgcagtatatttaagtttaaaagaattacgaaaacaa
ggtattaaaaactctgtacagtcttttcttttagaagttgaaagtaaaaagctcgatggt
ttctggctgcacatcgatgtcgatgttttaaacgactctgttatgccctgcgtggacagc
cgaactccagacggactgacttatgacgaatttaatgaacttacctcctatttgtttcaa
agtcaaaaactaagcggactcgaaattacaattctcgatccggatttagaccaaaccgga
gaatacactaaggaatttgtcgctaatattacctcaacttttaatcagaacttcaacaat
tag

DBGET integrated database retrieval system