KEGG   Flavobacterium johnsoniae UW101: Fjoh_4687Help
Entry
Fjoh_4687         CDS       T00508                                 

Definition
(GenBank) Arginase/agmatinase/formiminoglutamase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
fjo  Flavobacterium johnsoniae UW101
Pathway
fjo00220  Arginine biosynthesis
fjo00330  Arginine and proline metabolism
fjo01100  Metabolic pathways
fjo01110  Biosynthesis of secondary metabolites
fjo01130  Biosynthesis of antibiotics
fjo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fjo00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Fjoh_4687
   00330 Arginine and proline metabolism
    Fjoh_4687
Enzymes [BR:fjo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Fjoh_4687
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ABQ07686
JGI: Fjoh4687
UniProt: A5FAT5
Position
5667378..5668280
Genome map
AA seq 300 aa AA seqDB search
MKEITIVEFTSNLGLKEPQTGKEPGVNRLPDWLWKHNLHKAITPKNIVRLDPPRYSNIKD
PQTTILNADSLVTYAREQAYLINNLISANKFPFVLGGDCSILLGTAMALKQKGNYGLFYL
DGHTDFMDVSLSETGGTGGMIASIVTGNGHEKLTNILNLSPYIKEENLWCVGNREYDDEY
ENEIRKSSAVYLSLKELRKQGIKNSVQSFLLEVESKKLDGFWLHIDVDVLNDSVMPCVDS
RTPDGLTYDEFNELTSYLFQSQKLSGLEITILDPDLDQTGEYTKEFVANITSTFNQNFNN
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaataactattgtcgaattcacttctaatttgggcttaaaagaacctcaaacc
ggaaaagaaccaggcgtaaaccgtctgcccgattggttatggaaacacaatcttcataaa
gccattacaccaaaaaatatcgtaagacttgatccgcccagatattcaaacataaaagat
cctcaaactactattttaaatgcagactcattagttacttatgccagagaacaggcttat
ttgataaacaatttaatcagcgccaataaatttccttttgtacttggcggtgactgcagt
atacttttaggaaccgcaatggcattaaagcaaaaaggaaattacggtctattctatctc
gacggtcatactgattttatggatgtttctttatctgaaaccggcggtacaggcggcatg
attgcgtctattgttactggaaacggacacgaaaaattaaccaatattcttaacttgtct
ccatacataaaagaagaaaacctttggtgcgtgggcaatcgcgaatatgatgacgaatac
gaaaatgaaatcagaaaatcttctgcagtatatttaagtttaaaagaattacgaaaacaa
ggtattaaaaactctgtacagtcttttcttttagaagttgaaagtaaaaagctcgatggt
ttctggctgcacatcgatgtcgatgttttaaacgactctgttatgccctgcgtggacagc
cgaactccagacggactgacttatgacgaatttaatgaacttacctcctatttgtttcaa
agtcaaaaactaagcggactcgaaattacaattctcgatccggatttagaccaaaccgga
gaatacactaaggaatttgtcgctaatattacctcaacttttaatcagaacttcaacaat
tag

DBGET integrated database retrieval system