KEGG   Flavobacterium johnsoniae: Fjoh_4896Help
Entry
Fjoh_4896         CDS       T00508                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
fjo  Flavobacterium johnsoniae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:fjo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Fjoh_4896
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Fjoh_4896
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Fjoh_4896
Enzymes [BR:fjo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Fjoh_4896
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
5917515..5918696
Genome map
AA seq 393 aa AA seqDB search
MSFNVNEKGYYGEFGGAYIPEMLYPNVEELRQKYLSIMDEPDFKAEFNQLLKDYVGRPSP
LYFAKRLSEKYNTKVYLKREDLNHTGAHKVNNTIGQILLAKRLGKKRIIAETGAGQHGVA
TATVCALMGIECIVYMGEIDIARQAPNVARMKMLGAEVRPALSGSRTLKDATNEAIRDWI
NNPVDTHYIIGSAIGPHPYPDMVTRFQSIISEEIKWQLKEKEGRENPDYVVACIGGGSNA
AGTYYHFLHEPQVGIIAVEAAGKGVDSGHSAATSKLGKVGVIHGCKTLLMQTPDGQITEP
YSISAGLDYPGVGPLHAHLAQTGRGEFFSVTDDDAMNAGLQLTKLEGIIPAIESAHAFAV
LDQKKFKPEDIVVISLSGRGDKDLDNYIDYFKL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgagttttaacgttaacgaaaaaggatattacggggaatttggaggagcttacattcca
gaaatgttatatccgaatgtagaagaactacgccaaaaatacttaagcataatggacgaa
cctgattttaaggcagagttcaaccaattgcttaaagattatgtaggacgccctagtccg
ttgtattttgcaaaacgcttatcagaaaaatacaatacaaaggtttatctaaaaagagaa
gatttaaaccataccggagcgcataaagtcaacaacacaatcgggcagattttattagca
aaacgtttaggtaaaaaaagaattattgcagaaaccggtgcgggtcagcatggtgtggca
actgcaacagtctgcgcactaatgggaattgaatgcatcgtttatatgggagaaattgac
attgcgcgtcaggcaccaaacgttgcgcgtatgaaaatgcttggtgcagaagttcgtccg
gctctttcaggttcaagaaccttaaaagatgctaccaacgaagcaattcgtgattggatt
aataaccctgtagacacacattatatcattggatcggcaattggaccgcatccttaccct
gatatggtaacacgttttcagagtattatctcagaagaaataaaatggcagttaaaagaa
aaagaaggacgcgaaaatcctgattatgttgttgcctgcattggcggcggaagtaacgcc
gcaggaacctattatcactttctgcacgaaccgcaagttggaattattgctgttgaagca
gccggaaaaggtgttgacagcgggcacagtgctgcaaccagtaaattaggaaaagtcggc
gttattcacggttgtaaaacactgttaatgcagacgccagacggacaaattactgagcca
tattcgatttctgcgggacttgattatcctggagttgggcctttgcacgcacatttagca
caaaccgggcgcggcgaatttttctctgtaacagatgatgatgctatgaatgctggtttg
cagctgaccaaactagaaggaattattcctgctattgaaagcgctcatgcatttgcagtt
ttggatcagaaaaaattcaaaccagaagatattgtagtgatcagtctttcaggacgtgga
gataaagatttagataattatattgattactttaaattgtaa

DBGET integrated database retrieval system