KEGG   Flavobacterium johnsoniae: Fjoh_4899Help
Entry
Fjoh_4899         CDS       T00508                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
fjo  Flavobacterium johnsoniae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:fjo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Fjoh_4899 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Fjoh_4899 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Fjoh_4899 (trpA)
Enzymes [BR:fjo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Fjoh_4899 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
5920021..5920782
Genome map
AA seq 253 aa AA seqDB search
MNRITQKLQEDKKILSIYFSAGYPNLNDTVQIIQDLEKNGVDLIEIGLPFSDPLADGPTI
QASSTQALHNGMTTQILFDQLQNIRESVKIPLIIMGYFNPMLQYGVEAFCKKCAEIGIDG
LIIPDLPVDVYADEYKAIFEKYGLINVFLITPQTSDERIRFIDSVSNGFIYMVSSASVTG
SQSGFGNVQETYFERISNLNLKNPQIVGFGISNKETFNQATKYAKGAIIGSAFIKHLSES
GSGKIQEFVGEIR
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgaacagaataactcaaaaattacaagaagataaaaagatcctttcgatctatttttct
gcgggatatccaaatttaaatgataccgtgcagattattcaggatttagaaaaaaacgga
gttgatttaatcgaaatcggacttcctttcagtgatcctttggcagacggaccaactatt
caggcgagttctacacaggcacttcataacggaatgacaactcaaattctttttgatcag
ctgcaaaacatccgcgaaagcgtaaaaattccattaatcattatgggatatttcaacccg
atgttacaatacggagttgaagctttctgcaaaaaatgtgctgaaattggtattgatggt
ctaattatcccagatcttccggttgatgtttatgcagatgaatacaaagcaattttcgaa
aaatacggtttaattaatgtattcctaattacacctcaaacttcagatgaacgtattcgt
tttatagacagcgtttcaaacggatttatttatatggtaagttctgcaagtgttacagga
tcacaaagtggttttggaaatgttcaggaaacctattttgaaagaatttcaaatctaaat
ttaaaaaatcctcaaattgttggttttggaatttcaaataaagaaacttttaaccaagcc
actaaatatgcaaaaggagctattattggaagtgcttttatcaaacatttaagcgaaagc
ggcagtgggaaaattcaagagtttgttggagagattcgataa

DBGET integrated database retrieval system