KEGG   Flavobacterium johnsoniae: Fjoh_4946Help
Entry
Fjoh_4946         CDS       T00508                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
fjo  Flavobacterium johnsoniae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fjo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Fjoh_4946
Enzymes [BR:fjo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Fjoh_4946
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5974734..5975702)
Genome map
AA seq 322 aa AA seqDB search
MIKLKKNLITAALLLICCFSQAQFVKEHGQLSVLGIQLVDQNNQPIVLRGLSFGWHSMWP
RFYNEKAVSWLKKDFKCNVVRAAMGIELGEYSYIKDPKFSKEKIEAVVNGAIKSDIYVII
DWHSHNINLKEAKEFFAEMSKKYAKYPNIIYEIFNEPDYETWWEVKTYSEEVIRVIREND
PNNIILVGSPHWDQDVDLPAEDPILGYNNIMYTMHFYAATHGKDLRDKTDEAIKRGLPIF
ISESAGMEASGDGPLNVKAWQEYIDWMEAKKLSWITWSVSDKDETCSILKKSAKSEGKWK
DEDLKESGIEVREFLRKYNNQE
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgattaagttaaaaaaaaatttaattacagcggctcttttattaatctgttgtttctcg
caggcacagtttgtaaaagaacatggccagttaagtgttttaggaattcaattggtagat
caaaacaatcagccaatagtgctgcgtggtttaagttttggctggcatagtatgtggccg
agattttacaatgaaaaagcagtaagctggctgaaaaaagattttaaatgcaatgtggtt
cgcgccgcaatgggaattgaacttggagaatactcctatataaaagatccgaagttttca
aaagaaaaaatagaagctgttgtaaacggtgccataaaatcagatatatatgtaattatc
gattggcacagtcataatatcaaccttaaagaggcaaaagaattttttgccgagatgtct
aaaaaatatgccaagtatcctaatattatatatgagatatttaatgaacccgattatgaa
acctggtgggaagttaaaacctactcagaggaagtaatacgcgttattagagaaaatgat
ccaaataatattattttggttggaagtccgcattgggatcaggatgttgaccttccggca
gaagatccaattttaggatacaacaatataatgtataccatgcatttttatgcagcaaca
catggtaaagatttaagagataaaacagatgaagcaataaaaagaggtctgccaattttt
atttcagaatcagcagggatggaagcttctggagacggtccgctaaatgtaaaagcctgg
caggaatatattgactggatggaggctaaaaaactcagctggattacctggtcagtttct
gataaagacgaaacatgttctattctgaaaaaatcagcaaaatctgaagggaagtggaaa
gatgaagatttaaaagaatctggaatagaggttagagagtttttaagaaaatataataat
caagagtga

DBGET integrated database retrieval system