KEGG   Flavobacterium johnsoniae: Fjoh_4947Help
Entry
Fjoh_4947         CDS       T00508                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
fjo  Flavobacterium johnsoniae
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:fjo00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Fjoh_4947
  Lipid metabolism
   00561 Glycerolipid metabolism
    Fjoh_4947
   00600 Sphingolipid metabolism
    Fjoh_4947
Enzymes [BR:fjo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Fjoh_4947
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5975713..5976948)
Genome map
AA seq 411 aa AA seqDB search
MKKTIVLLAVLSSFNFGFSQGNTHTQTGGKFEGLAMTPPMGWNSWNTFAANIDEKLVKET
ADIMVSSGLAAAGYNYIVLDDGWMTKERDANGDLVPDPAKFPNGMKALIDYVHSKGLKFG
LYNCAGTQTCAGYPGTRGYEYQDARFYAKLGIDFLKYDWCNTKGITAPEAYTTMSNALKT
AGRPIVFSLCEWGDNQPWEWGKPVGNLWRISGDIYPCFDCEFKHPENWSSWGFMKIAEMR
KDIRKYSGPDHWNDFDMMEVGNEMNDTEDKSHFAMWCMLSSPLFTGNDYRKMSKETLAIL
TNKELIAINQDKLGIQGFKHSAEDGLEVWVKPLSDGNWAVTFLNRSDVSKKINFDWKKNT
FKDVDFGYEADFNKTAFKLKNLWTNKEAGSTKKNFTAELASHDCITLKLSL
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacaatagtactattagctgttttgagctcatttaattttggcttcagccaa
ggaaatacgcacacacaaacaggaggtaaatttgaaggtcttgccatgacaccgccaatg
ggatggaattcatggaatacttttgcagctaatatagatgagaaactggtaaaagaaaca
gcagatattatggtttcgtctggcttagctgctgcaggctataattatatagttttagat
gacggctggatgacaaaggaacgtgatgcaaatggcgatctggttcctgatccggctaaa
tttcctaacggaatgaaagctcttatagattatgtacacagcaaaggtttaaaatttggg
ttgtataattgcgcaggtacgcagacttgtgcaggatatcccgggactcgcggttacgaa
tatcaggatgctcgtttttatgccaaacttggaattgattttttaaaatacgattggtgt
aatacaaaaggcataacagcgccagaagcttataccacaatgagtaatgctttaaaaact
gctggaagaccaattgttttcagtctttgcgaatggggtgataatcagccgtgggagtgg
ggtaaaccagttggaaatctttggagaatatccggcgatatttatccttgttttgactgc
gaattcaaacatcctgaaaattggtcttcgtggggattcatgaaaattgccgaaatgcga
aaagatatccgtaaatattccggcccggatcattggaatgattttgatatgatggaagta
ggcaacgaaatgaacgataccgaagataaatcgcattttgctatgtggtgtatgctttct
tcaccattgtttaccggaaatgactatagaaaaatgtctaaagaaaccttggcaatttta
acaaacaaggagttaatcgcgataaatcaggataaattaggaatacaaggatttaaacat
tctgctgaagacggtttagaagtttgggtaaaacctttgtctgatggaaattgggcagta
acttttttaaatagaagtgatgtttctaaaaagattaatttcgactggaaaaagaatact
tttaaagatgttgattttggttacgaagctgattttaataaaacagcattcaagctaaaa
aatctttggacaaataaagaagcaggaagcaccaaaaagaactttacggcagagttagct
tctcatgactgcataacattgaaactatctctttaa

DBGET integrated database retrieval system