KEGG   Flavobacterium johnsoniae: Fjoh_4947Help
Entry
Fjoh_4947         CDS       T00508                                 

Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
fjo  Flavobacterium johnsoniae
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:fjo00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:fjo00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:fjo00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5975713..5976948)
Genome map
AA seq 411 aa AA seqDB search
MKKTIVLLAVLSSFNFGFSQGNTHTQTGGKFEGLAMTPPMGWNSWNTFAANIDEKLVKET
ADIMVSSGLAAAGYNYIVLDDGWMTKERDANGDLVPDPAKFPNGMKALIDYVHSKGLKFG
LYNCAGTQTCAGYPGTRGYEYQDARFYAKLGIDFLKYDWCNTKGITAPEAYTTMSNALKT
AGRPIVFSLCEWGDNQPWEWGKPVGNLWRISGDIYPCFDCEFKHPENWSSWGFMKIAEMR
KDIRKYSGPDHWNDFDMMEVGNEMNDTEDKSHFAMWCMLSSPLFTGNDYRKMSKETLAIL
TNKELIAINQDKLGIQGFKHSAEDGLEVWVKPLSDGNWAVTFLNRSDVSKKINFDWKKNT
FKDVDFGYEADFNKTAFKLKNLWTNKEAGSTKKNFTAELASHDCITLKLSL
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacaatagtactattagctgttttgagctcatttaattttggcttcagccaa
ggaaatacgcacacacaaacaggaggtaaatttgaaggtcttgccatgacaccgccaatg
ggatggaattcatggaatacttttgcagctaatatagatgagaaactggtaaaagaaaca
gcagatattatggtttcgtctggcttagctgctgcaggctataattatatagttttagat
gacggctggatgacaaaggaacgtgatgcaaatggcgatctggttcctgatccggctaaa
tttcctaacggaatgaaagctcttatagattatgtacacagcaaaggtttaaaatttggg
ttgtataattgcgcaggtacgcagacttgtgcaggatatcccgggactcgcggttacgaa
tatcaggatgctcgtttttatgccaaacttggaattgattttttaaaatacgattggtgt
aatacaaaaggcataacagcgccagaagcttataccacaatgagtaatgctttaaaaact
gctggaagaccaattgttttcagtctttgcgaatggggtgataatcagccgtgggagtgg
ggtaaaccagttggaaatctttggagaatatccggcgatatttatccttgttttgactgc
gaattcaaacatcctgaaaattggtcttcgtggggattcatgaaaattgccgaaatgcga
aaagatatccgtaaatattccggcccggatcattggaatgattttgatatgatggaagta
ggcaacgaaatgaacgataccgaagataaatcgcattttgctatgtggtgtatgctttct
tcaccattgtttaccggaaatgactatagaaaaatgtctaaagaaaccttggcaatttta
acaaacaaggagttaatcgcgataaatcaggataaattaggaatacaaggatttaaacat
tctgctgaagacggtttagaagtttgggtaaaacctttgtctgatggaaattgggcagta
acttttttaaatagaagtgatgtttctaaaaagattaatttcgactggaaaaagaatact
tttaaagatgttgattttggttacgaagctgattttaataaaacagcattcaagctaaaa
aatctttggacaaataaagaagcaggaagcaccaaaaagaactttacggcagagttagct
tctcatgactgcataacattgaaactatctctttaa

DBGET integrated database retrieval system