KEGG   Flavobacterium johnsoniae: Fjoh_4988Help
Entry
Fjoh_4988         CDS       T00508                                 

Definition
dehydrogenase catalytic domain-containing protein
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
fjo  Flavobacterium johnsoniae
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:fjo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Fjoh_4988
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Fjoh_4988
  Amino acid metabolism
   00310 Lysine degradation
    Fjoh_4988
Enzymes [BR:fjo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Fjoh_4988
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(6023954..6025309)
Genome map
AA seq 451 aa AA seqDB search
MARFELKLPKMGESVAEATITNWLKEVGDKIEADEAVLEIATDKVDSEVPSEVSGILVEQ
LFGKDDLVQVGQTIAIIETEGGDAPAVTPVVEVSVPAEAVEIEKTIEAVKETVTAPQDFA
GSDKFFSPLVKNIAKEEGISVAELDSIQGSGKDGRVTKDDIFKYIEDRKSGVVQAPKAVE
EAPKAVVETPKAVVETPKAEPVAQKSQQAVPVSVNGGDEIVEMDRMRKLISGYMTASVQT
SAHVQSFIEVDVTNIVKWRDKVKTAFEKREGEKLTFTPIMMEAVAKALKDFPGMNISVDG
DYIIKKKNINLGMAAALPNGNLIVPVIKNADQLNLVGMAKAVNDLGNRAKAGKLKPDDTQ
GGTYTVTNVGTFGSVFGTPIINQPQVGILALGAIRKVPAVIETPEGDFIGIRQKMFLSHS
YDHRVVDGALGGSFVKRVAEYLEAFDVERDF
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atggcaagatttgaattaaagcttccaaaaatgggagagagcgtcgctgaggcaaccatt
actaactggttgaaagaagtgggagacaaaattgaagctgatgaagctgtactggaaatt
gcaactgataaagttgacagcgaagtgccaagtgaagtatcaggaattttagttgaacaa
ttatttggcaaagatgatttagttcaggtagggcagactattgcaattatcgaaacagaa
ggtggtgatgcgcctgcagtaactccagttgtcgaagtttctgtacctgcagaagcagta
gaaatagaaaaaactatcgaagcagtaaaagaaaccgtaactgctccgcaggattttgca
ggatcagataaattcttttctcctctggtaaaaaatattgcaaaagaagaaggtatttct
gttgcagaactagatagtattcaaggttcaggaaaagatggccgagtaacaaaagatgat
atttttaaatatatagaagaccgcaagtcaggggttgtgcaagctccaaaagcagttgaa
gaagctccaaaagcagtggttgaaacaccaaaggctgttgttgaaactccaaaagcagaa
ccagtcgctcaaaaaagccagcaggctgttccggtttctgtaaacggtggtgacgaaatt
gtggaaatggacagaatgcgtaaactgatttcaggttacatgacagcttctgtacaaact
tcggctcacgttcaatcttttattgaggttgacgtaaccaacattgtaaaatggagagat
aaagttaaaaccgctttcgaaaaaagagaaggtgaaaaattgacttttacaccaattatg
atggaagcagttgcaaaagcgttaaaagatttccctggaatgaatatttctgttgatggt
gattatatcatcaaaaagaaaaacatcaatttaggaatggcagcagcattgccaaacgga
aatttaattgttcctgtaattaaaaatgcagatcagttaaaccttgttggaatggcaaaa
gcagttaacgatttaggaaaccgtgcaaaagcaggaaaactaaaaccagatgatacacaa
ggcggaacttacactgttacaaatgttggaacttttggaagtgtttttggaacgcctatt
attaatcagccacaggttggaattttagctcttggtgcgattcgtaaagttcctgcggtt
atcgaaactccagaaggagattttatcggaatccgtcaaaaaatgttcctgtctcactct
tacgatcatagagtggtagatggcgcattaggaggaagttttgtgaaaagagtagcagaa
tatttagaagcttttgatgtagaaagagatttctag

DBGET integrated database retrieval system