KEGG   Flavobacterium johnsoniae UW101: Fjoh_5007Help
Entry
Fjoh_5007         CDS       T00508                                 

Definition
(GenBank) Cytochrome-c peroxidase
  KO
K00428  cytochrome c peroxidase [EC:1.11.1.5]
Organism
fjo  Flavobacterium johnsoniae UW101
Brite
Enzymes [BR:fjo01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Fjoh_5007
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CCP_MauG Cytochrom_C zf-ZPR1 DUF1924 Cytochrom_C550 Cytochrome_CBB3 Cupin_4
Motif
Other DBs
NCBI-ProteinID: ABQ08006
JGI: Fjoh5007
UniProt: A5F9V9
Position
6045288..6046331
Genome map
AA seq 347 aa AA seqDB search
MLKIKYFLWLIIPLLWSCSNNEDEEYVNVPLEFKVPSNFPALAYNIELNPPTEKGFELGK
KLFYDGRLASDGVVSCGFCHIQANAFTHHGHTVSHGVNDAQGTRNTPSIQNLAYQNIFMY
DGAADHLDLQPIIPLTSIIEMNGDLNAILKMMKADKEYQKLFSQAFDDGAITTENMLKAL
SQFMVMVVSSNSKFDKYRRNEAGGTFTSEEQAGYDLFKSKCASCHATDLQTDNSFRNNGL
AVNPAVNDVGRYKVTELASDYYKFKVPSLRNVEVSGPYMHDGRFGTLEGVLDHYASGIED
SPTLDPILKQNGKFGIPLSATEKQQIIAFLKTLTDTQYLTDKRFAEY
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaaataaaatattttctatggctgattattccgttgttatggagctgttctaat
aatgaggatgaagaatatgtaaatgtacctttagaatttaaagtaccatctaactttcct
gctctggcttataacatcgaactaaatccacctacagaaaaaggattcgaattaggaaaa
aaattattctatgacggtcgtttagcttcagacggagttgtttcttgtggtttctgccat
atacaagccaatgcttttacgcatcacggacacaccgtaagccacggagtaaacgacgca
caaggaacaagaaatacgccgtcaattcaaaatttagcgtaccaaaacatttttatgtac
gatggcgcagcagatcatttagatttacagccaattattccgcttacaagtattattgag
atgaatggcgatttaaatgccattttaaaaatgatgaaagctgataaagaatatcaaaaa
ttgtttagtcaggcttttgacgatggcgcaatcacaaccgaaaatatgctgaaagccctt
tcgcagtttatggttatggttgtttcatcaaattcaaaatttgacaaatacagaagaaac
gaagccggcggtacttttacaagtgaagaacaggcaggatacgatttatttaaatcaaaa
tgcgcttcgtgtcatgctactgatttacaaaccgacaattcatttaggaataatggttta
gcagtaaatccggctgttaatgatgtaggaagatataaagttacagagcttgcatctgac
tattataaatttaaagtgccaagtttacgaaatgtagaagtttcgggtccgtatatgcac
gacggaagatttggaactctcgaaggtgttctggatcattatgccagcggtattgaggat
tctccaacattagaccctattttaaaacaaaatggaaaatttggaatcccgctttctgca
actgaaaaacagcagataattgcttttttgaaaacactgactgatacgcagtatttgaca
gataaacgtttcgctgaatattag

DBGET integrated database retrieval system