KEGG   Bernardetia litoralis: Fleli_0115Help
Entry
Fleli_0115        CDS       T02149                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
fli  Bernardetia litoralis
Pathway
fli00010  Glycolysis / Gluconeogenesis
fli00020  Citrate cycle (TCA cycle)
fli00620  Pyruvate metabolism
fli01100  Metabolic pathways
fli01110  Biosynthesis of secondary metabolites
fli01120  Microbial metabolism in diverse environments
fli01130  Biosynthesis of antibiotics
fli01200  Carbon metabolism
Module
fli_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:fli00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Fleli_0115
   00020 Citrate cycle (TCA cycle)
    Fleli_0115
   00620 Pyruvate metabolism
    Fleli_0115
Enzymes [BR:fli01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Fleli_0115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 DUF2118 Peptidase_M23 RnfC_N HlyD_3 GCV_H PYNP_C FlgM RskA
Motif
Other DBs
NCBI-ProteinID: AFM02615
UniProt: I4AF80
Position
130303..131979
Genome map
AA seq 558 aa AA seqDB search
MAEILIMPRLTDTMEEGVVASILVKEGDTIKSGDLLAEIETDKATMEWESFVDGEVLYIG
VTEGEGVPVNDPVLILGKKGEDISALKAKFGAGNNDSSEPSQKEETKETPKAEVKKEQPK
EEESTIKKVDTSSINAVVLRMRKMTDTMEEGVLASWLVKVGDKLKSGDVIAEVETDKATM
DFDIYDDGEVLYLAAEEGDSVPIDAPIAVIGEKGADYQALLDADNSSSSPKQETEKEQPK
QETQTVATPANNSASSNGNSEGRIFISPLAKKMAEENGYDINQIDGSGENGRITKKDIEN
FTPLAASSEAKEVSQAPQQAQVEVKAAPAFAQEGTRDEKVSQMRKAIAKSLSASKFTAPH
FYLTIAIDMDKAIETRKMLNELSDTKISFNDIVIKSTALALKKHPAINASWQGDTIRYND
NIHMGVAVAVDEGLLVPVVRFAEMKTLSQINKEVKEFAGKAKDKKLQPSDWEGSTFTISN
LGMFGIEEFTAIINAPNACILAVGTITQQPVVKEGEIVVGNIMKMTLSCDHRVVDGAVGA
AFLQTLKGLMENPLKMLV
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaatccttattatgccacgccttaccgatacaatggaagaaggcgttgtagca
agcatactcgtaaaagaaggcgacacaataaagtctggcgaccttttggcagaaattgaa
accgataaagcaacaatggaatgggaaagtttcgttgatggcgaagttttatatattggt
gtaactgaaggcgaaggcgttcctgtaaatgacccagttttgattttgggcaaaaaggga
gaagatatttcagctttaaaagcaaaatttggagcaggaaataatgattcttctgaacct
tctcaaaaagaagaaactaaagaaactccaaaagcagaagttaagaaagagcaacctaaa
gaagaagaatctacaattaagaaagtagatacttcatctataaatgctgttgttttgcgt
atgcgaaaaatgactgatacgatggaagaaggtgttttggcttcttggctcgtaaaagta
ggcgacaaacttaaatctggtgatgtcattgctgaagtagaaacagacaaagcaacaatg
gattttgatatttatgatgatggcgaagttctttatttggcagcagaagaaggtgatagt
gtgcctattgatgcgcctattgctgttattggagaaaaaggtgcagactatcaagctctt
ttagatgctgataattctagttcttcaccaaagcaagagacagaaaaagagcaaccaaaa
caagaaactcaaacagttgctacaccagcaaataattctgcttcttcaaatggaaattca
gaaggacgtatttttatttctcctttagccaaaaaaatggcagaagaaaatggttatgat
attaatcaaattgatggaagtggagaaaatggcagaattaccaaaaaagatatagaaaac
tttactcctttagcagcaagttcagaagcaaaagaagtttctcaagctcctcaacaagct
caagttgaagtaaaagcagctccagcatttgcgcaagaaggaacacgagatgagaaagtt
tcacagatgcgtaaagctattgcaaagagtctctctgcgagcaagtttacagcacctcat
ttttatttgacgattgctatagatatggataaagccattgagacacgcaaaatgctcaat
gaactttcggatacaaaaatatcttttaatgatattgtaatcaaatctactgctttagca
ctcaaaaaacatccagcaataaatgcttcttggcaaggtgataccattcgttataatgac
aatattcatatgggtgtggctgttgctgttgatgaaggtttgttagttcctgtggttcgt
tttgcagaaatgaaaacactttctcaaatcaataaagaagtaaaagagtttgctggaaaa
gcaaaagacaaaaaattacaaccttcagactgggaaggaagtacatttacaatttctaat
ttaggaatgtttggaattgaagaatttacggctatcatcaatgcaccaaatgcgtgtatt
ttggctgttggtacaattactcaacaacctgttgtaaaagaaggcgaaattgtggttgga
aatattatgaaaatgactttatcgtgtgaccatagagtagttgatggcgcagttggagca
gcatttttacagacattaaaaggattgatggaaaatcctttgaaaatgttggtataa

DBGET integrated database retrieval system