KEGG   Flexibacter litoralis: Fleli_0375Help
Entry
Fleli_0375        CDS       T02149                                 

Definition
3'(2'),5'-bisphosphate nucleotidase (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
fli  Flexibacter litoralis
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:fli00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(423229..424056)
Genome map
AA seq 275 aa AA seqDB search
MIEIAIIAAVKAGERIKEIYDKFDDENNTNYTTDNIVSYKSDNSPLTLADKEANKIIEKN
LIPLGLPILSEEGKITPYSERKDWDKFWLVDPLDGTREFVKRNGNFTVNIALMENNIPVV
GIIYVPVTGVLYVGELGKGTYKQELNQKNTIETAEKIIVKVSKRKNEEGIIAFKSQSHSG
AKDNNYLSQFNVKEIRRKGSSVKFCLVAEGVADLYYRNGTTMEWDTAAGEAILKAAGGIM
LNADTDTDLKYNKENLENPPFCAMNAAIFETFEKL
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgatagaaattgccatcatagcagccgtaaaagcaggcgagcgtatcaaagaaatttat
gacaaatttgatgatgaaaataacacaaattatacaacagataatattgtaagttataaa
tctgataattctcctcttacgcttgctgataaagaagcgaataaaattattgagaaaaat
ttgatacctctaggtttacctattttatcggaagaaggaaaaattacaccttattcagaa
cgtaaagattgggataaattttggcttgttgatcctcttgatggaacaagagagtttgta
aaacgaaatggaaattttacggtaaatattgccttgatggaaaataatattcctgttgtg
ggaattatttacgttcctgttactggtgttttgtatgtgggagagcttggaaaaggaaca
tataaacaagaattaaatcaaaaaaatacgatagaaacggcagaaaaaataattgtaaaa
gtaagcaaacgtaaaaatgaagagggaataattgcctttaaaagtcagtcgcattctggt
gcaaaagacaataattatttgagtcagtttaatgtaaaagagattcgtagaaaaggaagt
tctgtcaaattttgcttagttgctgaaggagttgctgatttatattatagaaatggaaca
acaatggaatgggacacagcagcaggggaagcaattttgaaagcagcaggaggaataatg
ttaaatgcagatactgatacagatttgaaatataataaagaaaacttagaaaacccacct
ttttgtgcaatgaatgcagctatttttgaaacttttgagaagttataa

DBGET integrated database retrieval system