KEGG   Flexibacter litoralis: Fleli_1148Help
Entry
Fleli_1148        CDS       T02149                                 

Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
fli  Flexibacter litoralis
Brite
Enzymes [BR:fli01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Fleli_1148
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1335894..1337756)
Genome map
AA seq 620 aa AA seqDB search
MKFPLFLLILVSILLFTVSCTNSQKETAQNNATKEVTNSFKEIEKIYLSNIEKCINNLEA
TKKALNFIDKDIEYNKIHIQKSQEHYREARAYFKKIEPILSFVDVENYKTLNAPNLLKVE
EEDATNIKINEPFGFQPLEELLFLEIDSIGNIEEEVIQTIQKNADKTLQRLRLIQRNTNL
SVYKNYHFLWLFRDAIFRVALTGITGFDSPSGISLDDNKIVYQELENYLSFFEAEFQNKE
IYQEWKESLQKSQRFLTQDDKTNFENFDRYSFIKNYTENQIEIWNKTVKDWKIEFPLELA
IQNDATSLFSDSTFNLNFFSDQQLGQISKDKIVLGKQLFNDVNLSSNKKMSCATCHQQDL
AFTDGKKFPKGQKRNSPTLMYAALQKSFFHDNRAGSLEGQIISVINNKTEFHTSAEILLE
AVKENSVYVQKFSELYSDSLTEQNIRTAMADYIRSLAPFSSKFDKNIKGIENTFTKNEIN
GFNLFMGKAACATCHFAPVFNGTIAPSFRESEMELIAVPSKNDTINAKIDEDLGRYDVFQ
TEEKKYFFKTPTLRNISKTAPYMHNGVYETLEEVMDFYNRGGGKGIGIDLKYQTLPFESL
NLSKQEINDIIAFLESLEDE
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttcctcttttcctccttattttagtttctattctactttttactgtttcttgc
acaaattctcaaaaagaaacagcacaaaataatgctaccaaagaagtcacaaattctttc
aaagagatagaaaaaatctatttatcaaatatagaaaaatgtatcaataatttagaagca
accaaaaaagcactgaattttattgataaagatatagaatataataaaattcatatccaa
aaaagtcaagaacattatagagaagcaagggcttattttaaaaaaatagaaccaattttg
tcttttgtagatgttgaaaattataaaacactgaacgctccaaatctattgaaagtagaa
gaagaagatgctacaaatataaaaataaatgaaccttttggatttcaaccgttagaagaa
ttattattcttagaaattgattcaataggaaatattgaagaagaagtaatccaaaccatt
caaaaaaatgcagataaaactcttcaacgtcttcgtttgattcaaagaaatacaaattta
tcagtttataaaaattatcattttttgtggctttttagagatgctatttttagagttgcc
ttgacaggaattacgggatttgattcgccttcaggaatttcccttgatgataataaaata
gtgtatcaagaattagaaaattatttatccttttttgaagctgagtttcagaacaaagaa
atttatcaagagtggaaagaatcattgcaaaaaagccaaaggtttttaactcaagatgac
aaaaccaattttgaaaactttgatagatattcttttattaaaaattatacagaaaatcaa
attgagatttggaacaaaacagtaaaagattggaaaatagagtttccgttggagcttgcc
attcaaaatgatgcaacttcgcttttttcagattctacatttaatctaaatttcttttct
gaccaacaattaggacaaatttccaaagataaaattgtgttgggaaaacagctttttaat
gatgtaaatctttctagcaacaaaaaaatgagctgtgcaacctgtcatcaacaagatttg
gcatttacagatggaaaaaaatttcctaaaggacaaaagagaaatagcccaacattgatg
tatgcagctttacagaaaagtttttttcatgataatagagctggaagtttggaaggacaa
attatttctgttatcaataataaaacagagtttcatacaagcgcagagattttgttagaa
gctgtaaaagaaaattctgtgtatgttcagaaattttcagagctgtattcagatagtttg
acagaacaaaacatcagaacggcaatggctgattatatccgaagtctagctcctttttct
tccaaatttgataaaaatataaaaggaatagaaaatacatttacaaaaaatgaaataaat
ggatttaatctttttatgggaaaggctgcttgtgcgacctgtcattttgcgcctgttttt
aatggaacaattgcgccttcttttagagaatctgaaatggaacttattgctgttccatca
aaaaatgatacaattaatgcaaaaattgatgaggatttgggaagatatgatgtttttcaa
acagaagaaaaaaagtattttttcaaaactccaacccttcgaaatatttcaaaaacagct
ccttatatgcacaatggagtttatgaaactctggaagaagtaatggatttttataaccgt
ggtggtggaaaaggaattggaattgacctaaaatatcaaacattgccttttgaatctttg
aatttatccaaacaagaaattaatgatataatcgccttcttagaatctttagaagatgaa
taa

DBGET integrated database retrieval system