KEGG   Flexibacter litoralis: Fleli_1168Help
Entry
Fleli_1168        CDS       T02149                                 

Definition
2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
fli  Flexibacter litoralis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fli00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Fleli_1168
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Fleli_1168
  Amino acid metabolism
   00310 Lysine degradation
    Fleli_1168
Enzymes [BR:fli01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Fleli_1168
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1367036..1368577)
Genome map
AA seq 513 aa AA seqDB search
MAKEMKIPTVGESITEVVIANWLVEDGDHVEMDDLICELESDKATFEVPAEADGIIRFKA
EAGDTLEIGALLCVIEEGENGSEFKEETKSEAKEAPKQESSAKVEDYIMKIPTVGESISE
VVLANWLVEDGEEVELDDPICELESDKANFEVPAEKAGKVFHMVEAGSTLAIGDDFAKIE
VGGNSASSSSSVEETSVPNTAASSNGDSYAEGHASPAAAKILAEKGIDTKDVKGTGRDGR
ITKEDAQNAQKIAKAPAPKQSAKKDVKAPASTETSQGDRSTKVERMSSLRKTIARRLVAA
KNQTAMLTTFNEVDMSAVMEMRKKYKDKFKEKNEVGLGFMSFFTKAVTMALMEIPGVNAQ
ITGEKEDEILYHNYADVSIAVSSPRGLVVPVIRNAEQLSFAGVEKEVVRLAVKARDGKLT
IDEMSGGTFTITNGGIFGSMLSTPIINAPQSAILGLHNIVQRPIAVDGKVEIRPIMYIAL
SYDHRIVDGKESVTFLYRIKELIEDPSRLLLGV
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaatgaaaatacctaccgttggcgaatctatcacagaagtagtcatcgca
aactggcttgtagaagatggcgaccatgttgaaatggatgaccttatctgtgaattagaa
tctgataaagcaacttttgaagttcctgctgaagctgatggaatcataagatttaaggca
gaagctggtgatactttagaaataggcgcacttctttgtgtaatcgaagagggagaaaat
ggaagcgaatttaaagaagaaactaaatcagaagccaaagaagcaccaaaacaagagtct
tcagcaaaagttgaagattatatcatgaaaattccgacagtaggagagtctatttcggaa
gttgtattggctaattggcttgtagaagatggcgaagaagtagaattagatgaccctatt
tgtgaattagaatctgataaagcaaattttgaagttcctgctgaaaaagctgggaaagta
ttccacatggtcgaagctggttctacacttgctatcggagatgattttgctaaaattgaa
gtaggtggaaatagtgcttcttctagctcaagtgtcgaagaaacaagcgtgcctaataca
gcagcatcttctaatggagattcttatgcagaaggacatgcatctccagcagcagcaaaa
atattagctgaaaaaggaattgatactaaagatgtaaaaggaacaggaagagatggaaga
ataacaaaagaagatgctcagaatgctcaaaaaatagctaaagcaccagcaccaaaacag
tctgccaaaaaagatgttaaagcaccagcaagtactgaaacttcacaaggcgaccgtagc
acaaaagtagagcgtatgtcttcacttcgtaaaacgattgcaagacgtttagttgctgca
aaaaatcaaactgctatgcttactactttcaatgaagtagatatgtcagcagttatggaa
atgcgtaagaaatacaaagacaagtttaaagaaaaaaatgaagttggtttgggctttatg
tctttctttacaaaagctgtaacaatggctttgatggaaattccaggagtaaatgctcaa
attacaggcgaaaaagaagacgaaattttatatcacaattacgctgatgtttctattgct
gtttcttctcctcgtggtttggttgttcctgttattcgtaatgcagagcaattatctttt
gctggtgtagaaaaagaagttgttcgtttggctgtaaaagctagagatggcaaacttact
attgatgagatgtctggtggaacgttcactatcacaaatggtggtatttttggctcaatg
ctttctactccaattattaatgctcctcaatcagctattttaggactgcataatattgtt
caacgccctattgctgttgatggcaaagtagaaattcgtccaattatgtacattgcactt
tcttatgaccaccgaattgtagatggtaaagaatctgtaactttcctttatagaattaaa
gaacttattgaagacccttcaagattacttttgggtgtttaa

DBGET integrated database retrieval system