KEGG   Bernardetia litoralis: Fleli_1168Help
Entry
Fleli_1168        CDS       T02149                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
fli  Bernardetia litoralis
Pathway
fli00020  Citrate cycle (TCA cycle)
fli00310  Lysine degradation
fli01100  Metabolic pathways
fli01110  Biosynthesis of secondary metabolites
fli01120  Microbial metabolism in diverse environments
fli01130  Biosynthesis of antibiotics
fli01200  Carbon metabolism
Module
fli_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fli_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fli00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Fleli_1168
  Amino acid metabolism
   00310 Lysine degradation
    Fleli_1168
Enzymes [BR:fli01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Fleli_1168
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AFM03606
UniProt: I4AI21
Position
complement(1367036..1368577)
Genome map
AA seq 513 aa AA seqDB search
MAKEMKIPTVGESITEVVIANWLVEDGDHVEMDDLICELESDKATFEVPAEADGIIRFKA
EAGDTLEIGALLCVIEEGENGSEFKEETKSEAKEAPKQESSAKVEDYIMKIPTVGESISE
VVLANWLVEDGEEVELDDPICELESDKANFEVPAEKAGKVFHMVEAGSTLAIGDDFAKIE
VGGNSASSSSSVEETSVPNTAASSNGDSYAEGHASPAAAKILAEKGIDTKDVKGTGRDGR
ITKEDAQNAQKIAKAPAPKQSAKKDVKAPASTETSQGDRSTKVERMSSLRKTIARRLVAA
KNQTAMLTTFNEVDMSAVMEMRKKYKDKFKEKNEVGLGFMSFFTKAVTMALMEIPGVNAQ
ITGEKEDEILYHNYADVSIAVSSPRGLVVPVIRNAEQLSFAGVEKEVVRLAVKARDGKLT
IDEMSGGTFTITNGGIFGSMLSTPIINAPQSAILGLHNIVQRPIAVDGKVEIRPIMYIAL
SYDHRIVDGKESVTFLYRIKELIEDPSRLLLGV
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaatgaaaatacctaccgttggcgaatctatcacagaagtagtcatcgca
aactggcttgtagaagatggcgaccatgttgaaatggatgaccttatctgtgaattagaa
tctgataaagcaacttttgaagttcctgctgaagctgatggaatcataagatttaaggca
gaagctggtgatactttagaaataggcgcacttctttgtgtaatcgaagagggagaaaat
ggaagcgaatttaaagaagaaactaaatcagaagccaaagaagcaccaaaacaagagtct
tcagcaaaagttgaagattatatcatgaaaattccgacagtaggagagtctatttcggaa
gttgtattggctaattggcttgtagaagatggcgaagaagtagaattagatgaccctatt
tgtgaattagaatctgataaagcaaattttgaagttcctgctgaaaaagctgggaaagta
ttccacatggtcgaagctggttctacacttgctatcggagatgattttgctaaaattgaa
gtaggtggaaatagtgcttcttctagctcaagtgtcgaagaaacaagcgtgcctaataca
gcagcatcttctaatggagattcttatgcagaaggacatgcatctccagcagcagcaaaa
atattagctgaaaaaggaattgatactaaagatgtaaaaggaacaggaagagatggaaga
ataacaaaagaagatgctcagaatgctcaaaaaatagctaaagcaccagcaccaaaacag
tctgccaaaaaagatgttaaagcaccagcaagtactgaaacttcacaaggcgaccgtagc
acaaaagtagagcgtatgtcttcacttcgtaaaacgattgcaagacgtttagttgctgca
aaaaatcaaactgctatgcttactactttcaatgaagtagatatgtcagcagttatggaa
atgcgtaagaaatacaaagacaagtttaaagaaaaaaatgaagttggtttgggctttatg
tctttctttacaaaagctgtaacaatggctttgatggaaattccaggagtaaatgctcaa
attacaggcgaaaaagaagacgaaattttatatcacaattacgctgatgtttctattgct
gtttcttctcctcgtggtttggttgttcctgttattcgtaatgcagagcaattatctttt
gctggtgtagaaaaagaagttgttcgtttggctgtaaaagctagagatggcaaacttact
attgatgagatgtctggtggaacgttcactatcacaaatggtggtatttttggctcaatg
ctttctactccaattattaatgctcctcaatcagctattttaggactgcataatattgtt
caacgccctattgctgttgatggcaaagtagaaattcgtccaattatgtacattgcactt
tcttatgaccaccgaattgtagatggtaaagaatctgtaactttcctttatagaattaaa
gaacttattgaagacccttcaagattacttttgggtgtttaa

DBGET integrated database retrieval system