KEGG   Flexibacter litoralis: Fleli_1633Help
Entry
Fleli_1633        CDS       T02149                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
fli  Flexibacter litoralis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:fli00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Fleli_1633
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Fleli_1633
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Fleli_1633
Enzymes [BR:fli01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Fleli_1633
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1944733..1946046)
Genome map
AA seq 437 aa AA seqDB search
MNYSSTNGDTQVGSLCEALFQTFSSKGGLLMPEVINLLPKEFLLNLHTFSFQEICLKVCL
NLFGDEIPEEDLAKIIQKAFNFEIPLVEIYEKEVYSLELFHGKTLSFKDIGMSFMAELMS
YFLEKEKESQDITVLVATTGDTGSAAASAFFKRKGIKLCILYPKNKLSLLQEKQLNTWGE
NITALEIDGTYEDCKNLVREVLIDKELNKKIRLTTANSHNIARLLPQCVYYFWAVAQLKG
EKRTTIFSVPSGNFGNLTAGIIAKKMGLRISRFIAATNINDVVPQYLLNGSFEPRPAIRT
ISSSMDTGNPVNFKRLLTLYNHSYTRFSADIAGYRLTDRRTKNTLKDLYEGYNYLADPHS
TVAYAALKNYLTPESEVGIFLASAHPVKYYEVVKQTIPDVELEMPSFLEETLRKEKKVVS
LSSKIDGLKAFLSNTPN
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgaattattctagtacaaacggagatactcaagttggttctctatgtgaagccttattt
caaacttttagctcaaagggtggacttttgatgcccgaagtaataaatcttttgccaaaa
gagtttctgttgaatcttcatactttttcatttcaagaaatttgtttgaaagtgtgtttg
aatttatttggagatgaaattcctgaagaagatttagcaaaaataattcaaaaggctttt
aattttgaaattccattagtagaaatttatgaaaaagaagtttattcgttagagcttttt
catggcaaaacactttcttttaaagatataggaatgtcatttatggcagagctaatgagt
tattttttggagaaagaaaaagaaagtcaagatattacggttttggtagccactactgga
gatactggaagtgctgctgcaagtgcatttttcaaacgaaaaggcataaaattatgtatt
ctttatccaaaaaataaattgagtttgttgcaagaaaaacagctcaatacatggggagaa
aatattacagctttagaaattgatggaacttatgaagattgcaaaaatcttgtcagagaa
gttcttatagataaagaattaaataaaaaaatccgacttacaacagcaaattctcataat
attgctcgtcttttgcctcaatgtgtgtactatttttgggctgttgcacagctaaaagga
gaaaaaagaactactattttttctgttccgagtggaaattttggaaatcttacagcagga
attattgccaaaaaaatgggacttcgaattagtcgctttattgcagcaacaaatataaat
gatgttgttcctcaatatttattaaatggaagttttgagcctcgtcctgctattcgtact
atttctagctcaatggacacaggaaatccagttaattttaagcgtttattaactctttat
aatcattcttatactcgtttttcggcagatattgcaggatatagactgacagaccgaaga
acaaaaaataccctcaaagacctttatgaagggtataattatctagcagacccacattct
acggttgcttatgcagcactcaaaaattatctcactccagaaagtgaagtaggtattttt
cttgcttcagcccatccagtcaaatattatgaagtcgtaaagcagactattccagatgta
gaattagaaatgccttcttttttggaagaaacattgagaaaagaaaagaaagtagtatct
ctatcttctaaaattgatggtttgaaagcatttttaagcaatacacctaattaa

DBGET integrated database retrieval system