KEGG   Flexibacter litoralis: Fleli_1749Help
Entry
Fleli_1749        CDS       T02149                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
fli  Flexibacter litoralis
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fli00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Fleli_1749
Enzymes [BR:fli01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Fleli_1749
Peptidases [BR:fli01002]
 Cysteine Peptidases
  Family C44
   Fleli_1749
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2087808..2089742
Genome map
AA seq 644 aa AA seqDB search
MCGITGIFAFNEIGRFSLVRLQEATEKLEHRGKDAQRLYNDFFVGLGHRRLSILDLSSAA
TQPMSSKDERYTIVFNGEIYNFKELRKEYLSDLEFNTESDTEVLLQLYIRFKEKCLEKLN
GFFTFSVYDNQEQSMFIARDRVGIKPLLYYHDNDKFIFSSEMDSLMAYHFPKKIDWASVR
LYFSLHYIPAPNTIFENVYKLPAGHYLKVKKKEVVLEKYYEIPKNYENQDYLSISYEDSQ
KELVRLLDQSVKERLISDVPIGSFLSGGTDSSAIVALATRHTKHLNTFSIGYKDEPLFDE
TSYANLVAKKFDTNHTVFTLSNNDIYEAVFEMLPFLSEPFADSSAIPFYVLSKRTKQAAS
VALSGDGGDELFAGYNKYLGEYKVRNAGWKENLIKGNLGILEKLPKSRNSFWGNKFRQVH
RFAKAAQLSKQERYWFLSSFIDEQNIQNIFQSDVFELSNEDNKFQNRKKEYTKFISESKK
RDINEMLYADMNLLLPNDMLHKADQFSMAHALEVRVPFLDHNIVNFAFQIGENYKINPKI
KKRIVQDAFKDILPAELYNRSKHGFDVPLAKGFQTLLKPLVEESLDRDFIQEQGVFSPVY
TENLKQKVKQGTDYDQNHIWAFIVFQQWWKKYDIQKTIEEEEEF
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaataacaggaatatttgcctttaatgagattggtcgtttttcgttggtacgt
ttgcaagaggcaactgaaaaattagaacatcgtggaaaagatgcacaacgattatacaat
gatttttttgttggtttggggcatcgtcgattatctattttagatttatcttcggctgca
actcaacccatgagcagtaaagacgaacgttataccattgtttttaatggagaaatatat
aattttaaagaactcagaaaagagtatttaagtgatttagaatttaatactgaaagtgat
accgaagttttgcttcagctttatattcgttttaaagaaaaatgtcttgaaaaactcaat
ggtttttttacgttttcagtatatgataatcaagaacaatcaatgtttattgctcgggat
agagtcggtataaaaccacttttatattatcacgataatgataaatttattttttcttct
gaaatggactcgttaatggcatatcattttccaaaaaaaatagactgggcaagtgtgcgt
ttgtatttttctctgcattatattcctgcacccaatactatttttgaaaatgtctataaa
cttcctgctgggcattatctcaaagtaaagaaaaaagaagttgttttagagaaatattac
gaaattcctaaaaactacgaaaatcaggattatttatctatttcttacgaagactctcaa
aaagaattagtccgattattagaccaatctgtaaaagaaagacttatttctgatgttccg
attggctcttttttgagtggtggaacagattcttctgccattgtagctttggcaactcgc
cataccaaacacctcaatactttttcgattgggtacaaagacgaacctctttttgatgaa
acaagttatgccaatcttgtagccaaaaaatttgataccaatcataccgtttttacgctt
tcaaataatgatatttatgaagctgtttttgaaatgttaccttttttgagtgaacctttc
gctgattcttcggctattccattttatgttttgagtaaaagaaccaaacaagcagcctca
gtggctctttctggagatggtggagacgaactttttgcaggttacaataaatatttggga
gaatataaagtcagaaatgcaggttggaaagaaaatttaataaaaggaaatttaggaata
ttggaaaaattaccaaaatccagaaattcattttggggaaataaattcagacaagtacat
cgttttgcaaaggctgcacaattatcaaaacaagaacgttattggtttttgagtagtttt
attgatgaacaaaatattcaaaatatctttcaatctgatgtttttgagttatcaaatgaa
gataataaatttcaaaatcgtaaaaaagaatacacaaaatttatttctgaaagcaaaaaa
cgtgatattaatgaaatgttgtatgctgatatgaatttgcttttgccaaatgatatgctt
cataaggccgaccaattttcaatggctcatgctttagaagttcgtgttccttttcttgac
cacaacatcgtaaattttgcctttcagattggagaaaattataaaattaatccaaaaata
aaaaagcgtattgttcaagatgctttcaaagatattcttcctgccgaattatataatcgt
agcaaacacggttttgatgttcctctagcaaaaggatttcaaacacttttaaagccactt
gtagaagaatctttggatagagattttatacaagaacaaggagtttttagtcctgtttat
accgaaaatctaaaacaaaaagtaaaacaaggaacagattatgaccagaatcatatctgg
gcatttattgtttttcaacagtggtggaaaaaatatgatattcaaaaaacgattgaagaa
gaagaagagttttaa

DBGET integrated database retrieval system