KEGG   Bernardetia litoralis: Fleli_1793Help
Entry
Fleli_1793        CDS       T02149                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
fli  Bernardetia litoralis
Pathway
fli00630  Glyoxylate and dicarboxylate metabolism
fli01100  Metabolic pathways
fli01110  Biosynthesis of secondary metabolites
fli01120  Microbial metabolism in diverse environments
fli01200  Carbon metabolism
Module
fli_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:fli00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Fleli_1793
Enzymes [BR:fli01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Fleli_1793
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: AFM04191
UniProt: I4AJQ6
Position
complement(2135269..2136585)
Genome map
AA seq 438 aa AA seqDB search
MSKTNGTSNKFAHRSAAELENDWKTSPRWKGITRDYTGEDVAKLRGSVKVEHTLGRMGSE
RLWDLINNEPYVNSLGAISGNQAVQQVKAGLKAIYMSGWQVAADGNNAGQMYPDQSLYPA
DSVPKMVTRVNNALLRADQIENAEGESSVHWLAPIVADAEAGFGGVLNAFELMKGMIEAG
AAGVHFEDQLSSAKKCGHMGGKVLVPTKEAVQKLKAARLAADVLDVPTVLIARTDANGSF
LITSDIDEVDAPFISDEPRTSEGFFVLKGGIEAAVARGLAYAPYADVVWCETGKPDVEEA
RYFAEKIHEQFPGKLLAYNCSPSFNWTANLDKDTIASFQKQLGEMGYKYQFVTLAGFHSL
NMGMYELASKYKTEGMAAYSRLQDKEFDYEEKGYTGTKHQRFVGAGYFDQVAQAIVGEGL
STAALKGSTEEEQFHEAK
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagacaaacggaacttcgaacaaattcgctcacagaagcgcagcagaattagaa
aacgattggaaaacatctccacgttggaaaggcattactagagattatacaggagaagat
gtagctaaattgcgtggttcagtaaaagtagaacatactttagggcgcatgggttctgag
cgtttatgggatcttataaataatgaaccttatgtaaattctttgggagcaatctctgga
aaccaagctgtacaacaagtaaaagctggtttgaaagcaatttatatgagtggctggcaa
gtagcagcagatggaaacaatgctggacaaatgtacccagaccaaagtttgtaccctgcc
gatagtgttccaaaaatggtaactcgtgtaaataatgctttattacgtgctgaccaaatt
gaaaatgcagaaggtgaaagttcggtacattggttagctccaattgttgctgatgctgaa
gctggttttggtggtgttttgaatgcttttgaattgatgaaaggaatgattgaagcaggt
gcagcaggtgtacactttgaagaccaactttcttctgccaaaaaatgtggacacatggga
ggaaaagtattagttcctactaaagaagctgttcaaaaactaaaagctgctcgtttggct
gctgacgttttggacgttcctactgttttgattgctcgtacagatgcaaatggttctttc
ttgattacaagtgatattgatgaagtagatgctccatttatttctgatgagcctcgtact
tcagaaggattttttgttttgaaaggtggtatcgaagctgctgttgctcgtggacttgct
tatgcaccttatgctgatgttgtttggtgtgaaactggaaaacctgacgtagaagaagct
cgttattttgctgaaaaaatccatgaacaattcccaggtaaattattggcttacaactgt
tcaccttctttcaactggactgctaatttggataaagacacaattgctagtttccaaaaa
caattaggtgaaatgggttataaatatcaatttgtaacgcttgctggtttccatagctta
aacatgggaatgtacgaacttgcatcaaaatataaaactgaaggaatggctgcttattct
cgtcttcaagacaaagaatttgattacgaagaaaaaggttatacaggaactaaacaccaa
cgttttgtaggtgctgggtattttgaccaagtagctcaagctattgtaggcgaaggttta
tctactgctgccttgaaaggttcgacagaagaagagcaatttcacgaagctaaataa

DBGET integrated database retrieval system