KEGG   Flexibacter litoralis: Fleli_1794Help
Entry
Fleli_1794        CDS       T02149                                 

Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
fli  Flexibacter litoralis
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:fli00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Fleli_1794
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Fleli_1794
   00630 Glyoxylate and dicarboxylate metabolism
    Fleli_1794
Enzymes [BR:fli01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Fleli_1794
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2136815..2138446)
Genome map
AA seq 543 aa AA seqDB search
MSNTKSELQAKLEVKGNVTPEFEKILTPEALVFLAELHQKFDARRHELLEKRNQKQAEID
KGNMPTLLAETKHIREDKTWKVAPIPQDLQDRRVEITGPVERKMMINALNSGANIFMADF
EDSSSPTWQNAVQGQINCYDAIRKTITFHDAKKNKDYKLNEETAVLLVRPRGWHLDEKNL
LIDGNPISGGLFDFGLYVFHNAKELMNRGSGAYFYLPKIESHLEARLWNDAFVFAENYLD
IPVGTFKATVLLETIMASFEIEEILYELKDHMAGINAGRWDYIFSAIKKFRNVVKNPLPD
RGQITMTVPFMKAYTELLVKACHTRGAHAIGGMSAFIPTRHDEEINKQAFEKVRKDKERE
ANDGFDGSWVAHPDLVKVAKDVFDAKFGDKPNQKERLREDVNIEEMVKELTNFDIEGGTI
TDAGVRMNFNVGIRYIASWLDGVGAAAIFNLMEDAATAEISRTQLWQWLNNPNAKLTDET
AITEDYLRKCMEEEYQSIKDEAATYKGFDFENSKFPKAKELMEGLVFTKEYKDFLTTEAY
HLL
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgtctaatacaaaatctgaactccaagcaaaattggaagtgaaagggaatgttacgccc
gaatttgagaaaatactaacgcctgaagcacttgtttttttggcagaattacatcaaaag
tttgatgctcgtcgtcatgaattattagaaaaaagaaatcaaaaacaagccgaaattgat
aaaggaaatatgcctactctcttagcagagacaaagcatataagagaagacaagacatgg
aaagtagctcccattccacaagatttacaggatagaagagtagaaattacaggccccgta
gaaagaaaaatgatgataaatgcactaaattcaggtgcaaatattttcatggcagatttt
gaagattctagctctccgacgtggcaaaatgctgttcaaggtcagataaattgttatgat
gctattcgcaaaacaattacttttcatgatgcaaaaaaaaataaagattataaattgaat
gaggaaacagctgttttattagttcgccctcgtggttggcatcttgatgaaaagaattta
ttgattgatggaaatccgatttcaggtggtcttttcgattttggtttgtatgtttttcat
aatgcaaaagagcttatgaatcgtgggtctggtgcttatttctatcttccaaaaatagaa
tctcatttggaggctcgcctttggaatgatgcttttgtttttgcagaaaactatcttgat
attcctgtcggaacgttcaaagcaactgttcttttagaaactatcatggcttcttttgag
attgaagaaattctttacgaactcaaagaccacatggcaggaatcaatgcagggcgttgg
gattatattttttcagccatcaaaaaattcagaaatgtagttaaaaatccattacctgac
cgtggtcaaattacaatgacagttccatttatgaaggcttacactgaacttttggtaaaa
gcctgtcatacacgaggcgcacatgcgattggtggaatgtcggctttcataccgacaaga
cacgacgaagaaattaataaacaagcctttgaaaaagtgcgaaaagacaaagaacgagaa
gccaatgatggttttgatggttcttgggttgctcatccagatttggtaaaagtagcaaaa
gatgtttttgatgctaaatttggtgataaaccaaaccaaaaagagcgtttgagagaagat
gtaaatatagaagaaatggtaaaagaacttaccaattttgatattgaaggtggaacaatt
actgacgcaggtgtcagaatgaattttaatgttggcattcgttatattgcttcttggctt
gatggagttggtgcagcagctatttttaatctcatggaagatgcagcaacagccgaaatt
tcaagaacacagctttggcaatggctcaataatccaaatgcaaaattaacagatgaaact
gctattacagaagattatttgagaaaatgtatggaagaagagtatcaatctataaaagat
gaagctgcaacctacaaaggttttgacttcgaaaactcaaaatttccaaaagcaaaagag
cttatggaagggttagtatttacaaaagagtacaaagattttcttacaacagaagcctat
catttattataa

DBGET integrated database retrieval system