KEGG   Flexibacter litoralis: Fleli_2012Help
Entry
Fleli_2012        CDS       T02149                                 

Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
fli  Flexibacter litoralis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:fli00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Fleli_2012
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Fleli_2012
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Fleli_2012
Enzymes [BR:fli01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Fleli_2012
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2411073..2411882
Genome map
AA seq 269 aa AA seqDB search
MLKTDIITNRIDSLFQKKSNQVLTIYFTAGFPKLDDTRRILIELAEAGTDLIEIGMPFSD
PIADGETIQYSNKIALDNGMSIKKMFEQLEGIRNENGKIKETPIVLMGYLNPVLQFGIEE
FCKKCQEIGIDGFILPDLPLFEYELTYKSVFEKYGLHTIFLITPQTSEERIKKIDELSNG
FVYMVSSNSTTGNTSSKNEELSEKQSDYFKKIKSLNLKNPTQIGFGISDKKSFDQATSYS
NGAIIGSAFIRHLESGKSVKEFVESVTSK
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgctaaaaactgatataattacaaaccgtatagattctttattccaaaagaaatcgaat
caagttttgacgatttattttacggcaggttttccaaaactggatgatactcgtcgtatt
ttgatagaattagctgaagctggaactgatttgatagaaattggaatgcctttttctgac
ccaattgcagatggagaaactattcagtacagcaacaaaattgctttggataatggaatg
agcatcaaaaaaatgtttgaacaactggaaggaattagaaatgaaaatggtaaaataaaa
gaaactcctattgttttgatgggctatctaaatcctgttttgcaatttggaatagaagaa
ttttgtaaaaaatgtcaagaaataggaattgatggttttattttgcctgatttacctctt
tttgaatatgaactgacttataaatctgtgtttgaaaaatatggattacacaccattttc
cttatcactcctcaaacttcagaagagcgcatcaaaaaaattgatgagctaagtaatggt
ttcgtgtatatggtttcttcaaacagcacaacaggaaacacaagttctaaaaatgaagag
ttatctgaaaaacaaagtgattatttcaaaaaaataaaatcattaaatctcaaaaatcca
actcaaattggttttgggatttcggacaaaaaatcttttgaccaagctacttcttattct
aatggtgcaattataggttctgcttttattcgtcacttagaaagtggaaaatcagtaaaa
gaatttgtggaatcagttaccagtaaatag

DBGET integrated database retrieval system