KEGG   Flexibacter litoralis: Fleli_2085Help
Entry
Fleli_2085        CDS       T02149                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
fli  Flexibacter litoralis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:fli00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Fleli_2085
DNA repair and recombination proteins [BR:fli03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Fleli_2085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2490536..2491138)
Genome map
AA seq 200 aa AA seqDB search
MNYPSKLVEDAVNEISRLPGIGKKSALRLALHLLGQEVEDVTELTKSLIALRQKTVYCKK
CHTISDTDVCSICKSPKRNESLICVVEEVPDLLAIENTAQYNGLYHVLGGVISPIEGISP
SDLNIDSLLDRTQNGEVKEVILALNATMEGDTTAFYLTKKLRKQGIRVSGIARGVPIGSE
LEYTDEITLGRSIAKRIMFD
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaattatccttccaaattagtagaagatgctgtaaatgaaatttctcgtttaccaggt
attggcaaaaaatcagctttgcgtttggctttgcacctgcttggacaagaagtagaagat
gtaacagaattgacaaaatctttgattgcgcttcgtcagaagacggtttattgtaaaaaa
tgtcataccatttctgatactgatgtttgtagtatttgtaaaagtccaaaacgaaatgaa
agtttgatttgtgttgtggaagaagttccagatttgttagctatcgaaaatacagctcaa
tacaatggattatatcacgttttgggaggcgtaatttcgcctattgaaggaattagtcca
tcagatttgaatattgattctttattagaccgtactcaaaatggagaagtaaaagaagtt
attttggctctcaatgccacaatggaaggagatacaacggctttttatctaacaaaaaaa
ctacgcaaacaaggtataagagtaagtggaattgctcgtggtgttcctattggaagcgaa
cttgaatatacagatgaaatcacgctaggaagaagtattgccaaacgaattatgtttgat
taa

DBGET integrated database retrieval system