KEGG   Flexibacter litoralis: Fleli_2272Help
Entry
Fleli_2272        CDS       T02149                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
fli  Flexibacter litoralis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:fli00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Fleli_2272
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Fleli_2272
Enzymes [BR:fli01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Fleli_2272
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2720628..2721197
Genome map
AA seq 189 aa AA seqDB search
MRIILFNLFILSSLILVAAGCSNNPKTSDASDMSTTNPTSVETVYEFKVKDIDGNDVDLS
KYKGKKIMIVNVASKCGFTPQYEDLQNVKEKYSDKITILGFPANNFGGQEPGSNQEIKEF
CSAKFGVDFEMFSKISVKGSDRDPLYTWLAEKADEEPTWNFCKYIVGEDGKTVDFYNSRM
NPMEIVEKL
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgagaattatcttatttaatttattcattctaagctcactaattttagttgcagcaggt
tgttcgaataatccaaaaacatcagacgcatcagatatgagtaccacaaatccaacatca
gtagaaacagtttatgaatttaaggtaaaagacattgacggaaatgatgttgatttatca
aaatacaaaggcaaaaaaataatgattgtcaatgtagcttcaaaatgtggttttacacct
caatatgaagatttacaaaatgtaaaagaaaaatatagtgacaaaatcaccattttgggt
tttcctgcaaataactttggagggcaagaaccaggttcaaatcaagaaatcaaagagttt
tgctctgcaaaattcggtgtagattttgaaatgttttccaaaatttctgtgaaaggaagt
gaccgtgacccattatatacatggttggcagaaaaagcagatgaagaaccaacttggaat
ttttgcaaatatatagtaggcgaagatggaaaaacagttgatttttataattcaagaatg
aatccgatggaaattgtagaaaaattataa

DBGET integrated database retrieval system