KEGG   Flexibacter litoralis: Fleli_2320Help
Entry
Fleli_2320        CDS       T02149                                 

Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
fli  Flexibacter litoralis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2778984..2780096)
Genome map
AA seq 370 aa AA seqDB search
MKNILVLFLLISLSSCSEKENPEPETELTGIYPVEELLYFGDKNLPTDNITTYEGIELGR
KLFYDKRLSSDGTVSCATCHKQELAFTDGKAKSIGVNNAEMSVSAMSLVNLTWNNRLTWD
GKSQTLEEQAFLPMENHLEMNQDADITAQILSATDEYPVLFEAAFGSEEITPQKITKALA
QFERTLISNNSKYDKYLRGEYQATESELRGIQLFFTHPEAEQGIRGGNCGDCHLGSLTSG
STLGFEGLHNNGLDNDENLEEGLFSVTQNSYDKGKFRTPSLRNIALTAPYMHDGRFQTLE
EVIEHYDVGVQKSQTLSTLITAASNDFITDPNGEVRLALTEQEKQDIIAFLEMLTDEDFI
TNPAFSEPKQ
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatatactggtcttatttttactaatttctctttcttcctgttcagaaaaagaa
aatccagaacctgaaacagaacttacaggaatttatcctgttgaagaattactttatttt
ggagataaaaatcttcccacagataatataacaacttatgaaggaatagaattaggtaga
aaattattttatgataaacgactttcttctgatggaacggtttcttgtgcaacttgtcat
aaacaagaattggcatttacagatggaaaagcaaaaagtattggtgtaaataatgcagaa
atgtcagttagtgcaatgtctttagtaaatctaacttggaataatcgtttgacatgggac
ggaaaaagtcaaacattagaagaacaagcttttttgcctatggaaaatcatttagagatg
aatcaagatgcagatattacggctcaaattctttctgcaacagatgaatatccagtactt
tttgaagctgcttttggaagtgaagaaattacaccacaaaaaataacaaaagccttagca
caatttgaaagaacattaattagtaataattcaaaatatgataaatatttaagaggagaa
tatcaagcaacagagtctgaacttagaggcattcaattattttttacacatccagaggca
gaacaaggaatcagaggtggaaattgtggagattgtcatttgggttcgcttacttcagga
agtactttaggttttgagggcttacataataacggtttggataacgatgaaaacctagaa
gaaggattattttctgttactcaaaatagttatgataaaggaaaatttagaacgccatca
cttcgaaatattgccctcactgcgccctatatgcacgatggaagatttcaaacattagaa
gaagtcatcgaacattatgatgttggagttcaaaaaagccaaactctttcgacacttatc
acggcagcaagtaatgattttattactgacccaaatggagaagttcgtttagctttgact
gagcaagaaaaacaagatattattgcttttttggaaatgctaacagatgaagattttatt
acaaatcctgcttttagtgagccaaagcaatga

DBGET integrated database retrieval system