KEGG   Flexibacter litoralis: Fleli_2391Help
Entry
Fleli_2391        CDS       T02149                                 

Definition
L-glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
fli  Flexibacter litoralis
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fli00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Fleli_2391
   00330 Arginine and proline metabolism
    Fleli_2391
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Fleli_2391
Enzymes [BR:fli01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Fleli_2391
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2850351..2851265
Genome map
AA seq 304 aa AA seqDB search
MNFKEIIEEIYQKIKSIENKGELASYISELASVDVENFGIHISTIDQNNFGIGNWNDKFS
IQSIAKVLSLVLAYRMVGEKIWERLGVEPSGTPFNSLVQLEVDNGIPRNPFINSGAIVIS
DILLSNLENPKEEFLTFVRSLSNNSELNYSNKVAASEKAIGFRNIALCNFIKSFGNIKNE
PADVLDFYFDLCSLEMNCKELSDSFLFLANNGCRIVDNITILTKSQTKRINALMQTCGFY
DESGEFAFKVGLPGKSGVGGGIIALHPNQYTIAVWSPKLNKKGNSYKGMRFLEEFTTKSE
LSIF
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
gtgaattttaaagaaataattgaagagatatatcaaaaaattaaaagtatagagaataaa
ggagaattagcttcttatatttcagaattagcgagtgtagatgtagaaaattttggaata
catatatcaacgattgaccaaaataattttggtattggaaattggaatgataaattttct
attcaaagtattgcaaaagtattatcgctagttttggcttatagaatggtaggagaaaaa
atatgggaaagattaggcgttgagccatctggaactccatttaattcgcttgttcaactg
gaagtagacaatggcattcctagaaatccatttataaattctggtgcaatcgtaatttca
gatattcttcttagtaatttagaaaatccaaaagaagaatttttaacttttgttaggagt
ctttcaaacaattctgagttaaattattctaataaagtagctgcatcagaaaaagcaatt
ggttttcgaaatatagctctgtgtaattttattaagtcttttggaaatattaaaaatgaa
cctgctgatgttcttgacttctattttgacctttgttctcttgaaatgaactgtaaagaa
ctttcagattcattcttatttttggcaaataatggatgtagaatagttgataatattaca
atactaaccaaaagtcaaacaaaaagaataaatgcactcatgcaaacctgtggattttat
gatgaatctggagaatttgcatttaaagtcggactccctgggaaaagtggagttggagga
ggaattatagctctacatcccaatcaatatacgattgctgtttggagtccaaaattaaat
aaaaaaggaaattcgtataaaggaatgcgattcttagaagagtttacaacaaaatcagaa
ttatcaatattttaa

DBGET integrated database retrieval system