KEGG   Flexibacter litoralis: Fleli_2401Help
Entry
Fleli_2401        CDS       T02149                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
fli  Flexibacter litoralis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fli00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Fleli_2401
   01230 Biosynthesis of amino acids
    Fleli_2401
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Fleli_2401
   00030 Pentose phosphate pathway
    Fleli_2401
   00051 Fructose and mannose metabolism
    Fleli_2401
   00052 Galactose metabolism
    Fleli_2401
  Energy metabolism
   00680 Methane metabolism
    Fleli_2401
Enzymes [BR:fli01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Fleli_2401
Protein phosphatases and associated proteins [BR:fli01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Fleli_2401
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2863894..2864862)
Genome map
AA seq 322 aa AA seqDB search
MKKIGVFTSGGDSPGMNACLRAVVRGALYYGIEVYGIHRGYRGMIENDIHKMTSRDVSNI
IQRGGTILKTARSQRFMTKEGREKAYQNLKNLEIDGLIAIGGNGTLTGMKAFSEEHKIPF
VGAPGTIDNDLNGTDYTIGFDTAINTALEAIDKIRDTADSLERGFFIEVMGRHCGDIALL
TGIGGGAEIVMLPEIVDDLDEIVESITQMLANKKTSLIVVVAEGDELGNAEELGEKVKEK
IPKFKFRVTNLGHIQRGGSPTAADRVLASQLGLGAVEGLLSGKTNVMVGQLKRKLVYTSI
DECLKPRKIDNELIRMLRILSI
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattggagtttttacttctggaggagactctcctggaatgaatgcatgtttg
agagctgtcgtaagaggcgcactttattatggcatagaagtttatggaattcatagaggc
tatcgtggaatgattgaaaatgatattcataaaatgacttccagagatgtaagcaatatt
attcaacgtggaggtacaattttgaaaactgcacgcagtcagcgttttatgacaaaagaa
ggacgagaaaaagcctatcaaaatctaaaaaacctagaaatcgatggacttatcgccatt
ggtggaaatggaacacttacaggaatgaaagcattttcagaagaacacaaaataccattt
gtaggcgcacctggaacaattgacaatgatttgaatggtacagattatacaattggattt
gatacagcaattaatacagccttagaagccatcgacaaaatcagagatacagcagattca
cttgaacgaggtttttttatcgaagtaatgggcagacactgtggagatattgcgcttctg
acaggaattggaggaggagcagaaatagtaatgttgccagaaattgtggatgatttggat
gaaatagtagaatcaattacacagatgttagccaataaaaaaacttctttaattgtggta
gtggcagaaggtgatgagctaggaaatgctgaagagttgggcgaaaaagtaaaagaaaaa
atcccaaaatttaagtttagagtaaccaatttaggacatattcagcgtggtggttcgcca
acggcagccgatagagttctggctagtcagttgggtttgggagcagtagaaggacttttg
tctggaaaaacaaatgttatggttggacaattaaaacgaaaacttgtctatacttccata
gatgaatgtttgaaaccaagaaagattgataatgaacttattcgtatgttgcgtattttg
agtatctaa

DBGET integrated database retrieval system