KEGG   Bernardetia litoralis: Fleli_2401Help
Entry
Fleli_2401        CDS       T02149                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
fli  Bernardetia litoralis
Pathway
fli00010  Glycolysis / Gluconeogenesis
fli00030  Pentose phosphate pathway
fli00051  Fructose and mannose metabolism
fli00052  Galactose metabolism
fli00680  Methane metabolism
fli01100  Metabolic pathways
fli01110  Biosynthesis of secondary metabolites
fli01120  Microbial metabolism in diverse environments
fli01130  Biosynthesis of antibiotics
fli01200  Carbon metabolism
fli01230  Biosynthesis of amino acids
fli03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:fli00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Fleli_2401
   00030 Pentose phosphate pathway
    Fleli_2401
   00051 Fructose and mannose metabolism
    Fleli_2401
   00052 Galactose metabolism
    Fleli_2401
  Energy metabolism
   00680 Methane metabolism
    Fleli_2401
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Fleli_2401
Enzymes [BR:fli01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Fleli_2401
Protein phosphatases and associated proteins [BR:fli01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Fleli_2401
Messenger RNA biogenesis [BR:fli03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Fleli_2401
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK Paralemmin
Motif
Other DBs
NCBI-ProteinID: AFM04768
UniProt: I4ALD3
Position
complement(2863894..2864862)
Genome map
AA seq 322 aa AA seqDB search
MKKIGVFTSGGDSPGMNACLRAVVRGALYYGIEVYGIHRGYRGMIENDIHKMTSRDVSNI
IQRGGTILKTARSQRFMTKEGREKAYQNLKNLEIDGLIAIGGNGTLTGMKAFSEEHKIPF
VGAPGTIDNDLNGTDYTIGFDTAINTALEAIDKIRDTADSLERGFFIEVMGRHCGDIALL
TGIGGGAEIVMLPEIVDDLDEIVESITQMLANKKTSLIVVVAEGDELGNAEELGEKVKEK
IPKFKFRVTNLGHIQRGGSPTAADRVLASQLGLGAVEGLLSGKTNVMVGQLKRKLVYTSI
DECLKPRKIDNELIRMLRILSI
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattggagtttttacttctggaggagactctcctggaatgaatgcatgtttg
agagctgtcgtaagaggcgcactttattatggcatagaagtttatggaattcatagaggc
tatcgtggaatgattgaaaatgatattcataaaatgacttccagagatgtaagcaatatt
attcaacgtggaggtacaattttgaaaactgcacgcagtcagcgttttatgacaaaagaa
ggacgagaaaaagcctatcaaaatctaaaaaacctagaaatcgatggacttatcgccatt
ggtggaaatggaacacttacaggaatgaaagcattttcagaagaacacaaaataccattt
gtaggcgcacctggaacaattgacaatgatttgaatggtacagattatacaattggattt
gatacagcaattaatacagccttagaagccatcgacaaaatcagagatacagcagattca
cttgaacgaggtttttttatcgaagtaatgggcagacactgtggagatattgcgcttctg
acaggaattggaggaggagcagaaatagtaatgttgccagaaattgtggatgatttggat
gaaatagtagaatcaattacacagatgttagccaataaaaaaacttctttaattgtggta
gtggcagaaggtgatgagctaggaaatgctgaagagttgggcgaaaaagtaaaagaaaaa
atcccaaaatttaagtttagagtaaccaatttaggacatattcagcgtggtggttcgcca
acggcagccgatagagttctggctagtcagttgggtttgggagcagtagaaggacttttg
tctggaaaaacaaatgttatggttggacaattaaaacgaaaacttgtctatacttccata
gatgaatgtttgaaaccaagaaagattgataatgaacttattcgtatgttgcgtattttg
agtatctaa

DBGET integrated database retrieval system