KEGG   Flexibacter litoralis: Fleli_2405Help
Entry
Fleli_2405        CDS       T02149                                 

Definition
Holliday junction DNA helicase subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
fli  Flexibacter litoralis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:fli00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Fleli_2405
Enzymes [BR:fli01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Fleli_2405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2868684..2869268
Genome map
AA seq 194 aa AA seqDB search
MFAYLNGKITKREPSLAVLDINGVGYEVKISLQTYSIIQEGQPFKLFTYLSVTQDSQELF
GFATESEKKMFLQLISVSGVGRNTALVMLSAMNVSELADAIINNQTSVIQKIKGIGKKTS
ERLVLDLRDKLAKEGFQLQDENGMSSALKEQAANALISLGLSKLVADRTVNAILKKYGTD
ISLEELITYSLQEG
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcctatctcaacggaaaaatcacaaaaagagagccttcactagctgttttggat
attaatggcgtaggttatgaagtcaaaatttcacttcaaacttattctattattcaagaa
ggacaacctttcaaactttttacttatctaagtgtaacacaagattcacaagagcttttt
gggtttgcgacagaaagtgaaaaaaaaatgtttttgcagttgattagtgtttcgggagtt
ggaagaaatacagctttggtaatgctttcagcaatgaatgtttctgaactagcagacgca
attattaataatcaaacttctgttattcagaaaataaaaggaattggaaagaaaacttct
gagcgattggttttggatttgagagataaattggcaaaagaaggattccaacttcaagac
gaaaacggaatgagcagcgcactcaaagaacaagcagcaaatgcacttatcagtctagga
ttatcaaaattagtggctgacagaaccgtaaatgctattttgaaaaaatacggcacagat
atttctttagaagaattgataacttatagcttgcaagaaggataa

DBGET integrated database retrieval system