KEGG   Flexibacter litoralis: Fleli_2866Help
Entry
Fleli_2866        CDS       T02149                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
fli  Flexibacter litoralis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:fli00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3418432..3419226)
Genome map
AA seq 264 aa AA seqDB search
MKLKETSSNAQPKKVNGIHNHDKQDSQNFTTSTNKKKQVKKTKEKLLTHKQEDLEIIGEN
HIATSIETPLRKDAFELDDDTKIEKIAVHFKEIMDILGLDLTDDSLQGTPKRVAKMYVQE
IFKGLNPENKPATKMFENKFGYNQLLVEKNISFHSHCEHHFVPIHGKAHIAYISNEGVIG
LSKLHRIVDYFARRPQVQERLTNQIGEELKKMLGTEDIAVVLDAAHMCVSMRGIKDQTST
TITSFYSGKFNEEATRTEFLKYIQ
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgaaagaaacttcgtcgaatgcccagcctaaaaaggtaaatggcattcacaat
cacgataaacaagacagtcaaaacttcacaacttccaccaacaagaaaaaacaagtgaaa
aaaacaaaagaaaaattactaacccacaaacaagaagatttagaaataattggagaaaat
cacattgctacttccatagaaactcctttacgcaaagatgcctttgagcttgatgacgat
acaaaaatagaaaaaatagcagtacattttaaagaaataatggatattttgggtcttgat
ttgacagatgacagtttacaaggaacaccaaaacgagttgccaaaatgtatgtacaagaa
atttttaagggattgaatccagaaaataagccagctactaagatgtttgaaaataagttt
ggctacaatcaactcttagtagaaaaaaatattagttttcattcgcattgcgaacatcac
tttgttcctattcatggaaaagcacacattgcttatatttcaaatgagggagtgattggg
ctttcaaagttacatagaattgtagattattttgctcgtcgtccacaagtacaagagcgt
ttgaccaatcaaataggtgaagaattaaagaaaatgttaggaacagaagacatagctgtt
gttttagatgctgctcacatgtgcgtgtctatgagaggaattaaagaccaaaccagcaca
acaattacaagtttttatagtggaaaatttaatgaagaagctacacgtactgagtttttg
aaatatattcagtaa

DBGET integrated database retrieval system