KEGG   Bernardetia litoralis: Fleli_2866Help
Entry
Fleli_2866        CDS       T02149                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
fli  Bernardetia litoralis
Pathway
fli00790  Folate biosynthesis
fli01100  Metabolic pathways
Module
fli_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:fli00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Fleli_2866
Enzymes [BR:fli01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Fleli_2866
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI DUF4844 QueF
Motif
Other DBs
NCBI-ProteinID: AFM05219
UniProt: I4AMN4
Position
complement(3418432..3419226)
Genome map
AA seq 264 aa AA seqDB search
MKLKETSSNAQPKKVNGIHNHDKQDSQNFTTSTNKKKQVKKTKEKLLTHKQEDLEIIGEN
HIATSIETPLRKDAFELDDDTKIEKIAVHFKEIMDILGLDLTDDSLQGTPKRVAKMYVQE
IFKGLNPENKPATKMFENKFGYNQLLVEKNISFHSHCEHHFVPIHGKAHIAYISNEGVIG
LSKLHRIVDYFARRPQVQERLTNQIGEELKKMLGTEDIAVVLDAAHMCVSMRGIKDQTST
TITSFYSGKFNEEATRTEFLKYIQ
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgaaagaaacttcgtcgaatgcccagcctaaaaaggtaaatggcattcacaat
cacgataaacaagacagtcaaaacttcacaacttccaccaacaagaaaaaacaagtgaaa
aaaacaaaagaaaaattactaacccacaaacaagaagatttagaaataattggagaaaat
cacattgctacttccatagaaactcctttacgcaaagatgcctttgagcttgatgacgat
acaaaaatagaaaaaatagcagtacattttaaagaaataatggatattttgggtcttgat
ttgacagatgacagtttacaaggaacaccaaaacgagttgccaaaatgtatgtacaagaa
atttttaagggattgaatccagaaaataagccagctactaagatgtttgaaaataagttt
ggctacaatcaactcttagtagaaaaaaatattagttttcattcgcattgcgaacatcac
tttgttcctattcatggaaaagcacacattgcttatatttcaaatgagggagtgattggg
ctttcaaagttacatagaattgtagattattttgctcgtcgtccacaagtacaagagcgt
ttgaccaatcaaataggtgaagaattaaagaaaatgttaggaacagaagacatagctgtt
gttttagatgctgctcacatgtgcgtgtctatgagaggaattaaagaccaaaccagcaca
acaattacaagtttttatagtggaaaatttaatgaagaagctacacgtactgagtttttg
aaatatattcagtaa

DBGET integrated database retrieval system