KEGG   Flexibacter litoralis: Fleli_2890Help
Entry
Fleli_2890        CDS       T02149                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
fli  Flexibacter litoralis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:fli00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Fleli_2890
   01230 Biosynthesis of amino acids
    Fleli_2890
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Fleli_2890
   00051 Fructose and mannose metabolism
    Fleli_2890
   00562 Inositol phosphate metabolism
    Fleli_2890
Enzymes [BR:fli01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Fleli_2890
Exosome [BR:fli04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Fleli_2890
  Exosomal proteins of bladder cancer cells
   Fleli_2890
  Exosomal proteins of melanoma cells
   Fleli_2890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3443821..3444591
Genome map
AA seq 256 aa AA seqDB search
MRQKIVAGNWKMNLTKEEAQSLTSEIVGMNNDELGTNQKEVKLIICPSFIHISTIKSLFK
SSKNIYLGAQNVASQEKGAYTGEISAAMLSSYQVEYVIIGHSERRQYFKESNQEIAQKID
LIFANKMLPIFCCGETLELREEGNHVEFIKNQISESLFHLSASEFEKVIVAYEPIWAIGT
GKTASSEQAQEIHAEIRKHISSKYGKEIADKTPILYGGSCKPSNAKEIFACPDVDGGLIG
GAALKSRDFVEIAKSF
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcaaaaaattgtagcaggaaactggaaaatgaaccttactaaagaagaagctcaa
agtcttacttctgaaattgtaggaatgaataatgatgagctaggaacaaatcaaaaagag
gtaaaacttattatttgtccttcttttattcatatttctactataaaatctctgtttaaa
agctcaaaaaacatctatttaggagcgcaaaatgtagcatctcaagaaaaaggagcttat
acaggagaaatttcggctgctatgctttcttcctatcaagtagaatatgtaattatcgga
cacagtgaaagaagacaatattttaaagaatcaaatcaagaaattgctcaaaaaattgat
ttaatatttgctaataaaatgcttccaattttttgttgtggcgaaacattagaacttaga
gaagaaggaaatcatgttgaatttatcaaaaatcaaatctctgaaagtctgtttcattta
tcagcttctgagtttgaaaaagtaattgttgcttatgagcctatttgggcaattggaaca
ggaaaaacggcttctagtgagcaagcacaagaaattcatgcagaaataagaaagcatatt
tcatcaaaatatggaaaagaaattgctgacaaaacgccaattttgtatggtggtagttgt
aaacctagtaatgcaaaagaaatttttgcttgtcctgatgtagatggtggacttattgga
ggtgctgcattaaaatcaagagattttgtagaaattgcgaagtcattttaa

DBGET integrated database retrieval system