KEGG   Flexibacter litoralis: Fleli_2985Help
Entry
Fleli_2985        CDS       T02149                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
fli  Flexibacter litoralis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:fli00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Fleli_2985
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Fleli_2985
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Fleli_2985
Enzymes [BR:fli01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Fleli_2985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
3562066..3563304
Genome map
AA seq 412 aa AA seqDB search
MINQTENINTQKTILRSKISDERGYYGQFGGAYIPEMLYPNIEEITKAYYSLQNDEEFKK
EFRNLLRDYVGRPTPLYLAKRLSEKYGTKVYLKREDLNHTGAHKVNNTVGQVLLAKKLGK
NKIVAETGAGQHGVATATVCALMGMECIVFMGEIDIERQQPNVQRMKMLGAEVRPALSGS
KTLKDATNEAMRYWINNPVDTHYIIGSVVGPHPYPEMVAWFQSVISEEMRNQLTEKEGTP
NPDYVIACVGGGSNAAGAFYHYIDEKDVQLIGAEAAGLGISSGETAATIACGTLGVLHGS
KTLLMQTKDGQVVEPYSISAGLDYPGIGALHAYLADSKRAKFYAITDDEAMQAGEELALL
EGIIPAIESAHALAVLNNLKEDDKDFSKKVVIINLSGRGDKDLSAYSKYLGM
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgataaatcaaactgaaaatataaatacacaaaaaacaattttacgttctaaaatatct
gatgagcgaggttattatgggcaatttggaggtgcatatattccagaaatgctatatcca
aacattgaagaaattacaaaagcctattattctttacaaaatgatgaagaatttaaaaaa
gagtttcgcaatttattgagagattatgttggaagacctacacctctttatctagcaaaa
agattatctgaaaaatatggcacaaaagtctatttaaaacgtgaagacctcaatcacaca
ggcgcacacaaagtaaataatacagtcggacaagttcttttagctaaaaaattaggtaaa
aataaaattgtagctgaaacaggtgcaggacaacacggagtagcaacagcaacagtttgt
gctttgatgggaatggaatgcattgtttttatgggagaaatagatattgagcgtcagcaa
ccaaatgtacaaagaatgaaaatgctcggtgcagaagttcgtccagctctttctggaagt
aaaacattaaaagatgcaacgaatgaagcgatgcgttattggataaataatccagttgat
acacattatattattggttctgtggttggtcctcatccttatcctgaaatggtggcttgg
tttcaatctgtgattagcgaggaaatgagaaaccaacttacagaaaaagaaggaactcca
aatccagattatgtgattgcttgtgtgggtggtggaagtaatgcagcaggagctttttat
cattatatcgatgaaaaagatgttcaacttattggtgcagaagctgctgggttaggaatt
tctagtggagaaacagcagcaacaatagcttgtggaactttgggagttcttcacggaagc
aaaacgcttttgatgcaaacaaaagacggacaagtagttgagccgtattctatttcagca
ggcttggattatcctggtattggagctttgcacgcatatttggcagatagcaaacgagca
aagttttatgccattacagatgatgaagcaatgcaagcaggagaagaacttgcgctttta
gaaggaattattccagccatagaatcggctcacgccttagctgttttgaataacttgaaa
gaagatgacaaagattttagtaaaaaagtagtcattattaatctttcgggaagaggagat
aaagatttgagtgcttattcaaagtatttgggtatgtaa

DBGET integrated database retrieval system