KEGG   Flexibacter litoralis: Fleli_2993Help
Entry
Fleli_2993        CDS       T02149                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
fli  Flexibacter litoralis
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:fli00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Fleli_2993
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Fleli_2993
Enzymes [BR:fli01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Fleli_2993
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3572095..3573567
Genome map
AA seq 490 aa AA seqDB search
MEIIELLKNLKTQSIHGDLEIEINQIQFDSRKIAKNDAYVALKGTVADGHQFIKQAIQDG
AKLIVCEKLPVFLESHITYIQVEDTAQALGKLAGNFYGNPSKKLKLIGVTGTNGKTTVVT
ILYKLFKKLGYNVGLISTIHNKIKSRIYPSTHTTPNPVELNRLLAEMVKKRCTHVFMEVS
SHAIVQKRIEGLHFKGGVFTNISHDHLDYHGTFSDYIRAKKGFFDILPHTSFALVNQDDK
RGLVMLQNCKAKHVTFSMKSMSDYKVRIMDSSFEGMQLQIEEKHNEKINGKETWTKLIGN
FNAYNLLTVYAVAMLLEEDEDEILTELSNIKGVNGRFQRYTSSLGVHTIVDYAHTPDALE
NVLKTISEIKKPHQNLITVVGCGGNRDKTKRPEMAKIAANYSDWSIFTSDNPRTEKPKAI
IKDMLEGVKDVDCSKYQTIILRKEAIERACSMAQKDDIILVAGKGHETYQEINGERFDFD
DRVILKESLE
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggaaataattgaattactcaaaaatctaaaaacacaatctatacatggagatttagaa
atagaaataaatcaaatacagtttgattctcgcaaaatagcaaaaaatgatgcgtatgta
gccttaaaaggaacagtagcagacggacatcaatttatcaaacaagccattcaagatgga
gcaaaattgattgtttgtgaaaaattacctgtttttttagaatctcatattacctatatt
caagtagaagatactgcgcaggcattgggaaagctggcaggaaatttttatggaaatcct
tccaaaaaactgaagttaataggagtaacaggtacgaatggaaaaacaacagtcgtaaca
attctgtataaattatttaaaaaattagggtataatgttggacttatttcaacgattcat
aataaaataaaaagccgaatttatccttccacacacacaactccaaatccagtagagctt
aatcgtttgcttgccgaaatggtcaaaaaacgttgtacgcatgtttttatggaggtgagt
tcacatgcgattgttcaaaagcgtattgaaggacttcattttaaaggtggtgtttttact
aacatttcacacgaccatttggattatcatggtactttttcggattatattagagccaaa
aaaggcttttttgatattttacctcatacttcttttgccttggtcaatcaagatgacaag
cgaggtttggtgatgcttcaaaactgtaaagccaaacatgttactttttcaatgaaatct
atgtctgattataaagtcagaattatggatagttcttttgaaggaatgcagttgcagata
gaagaaaaacataatgaaaaaataaacggaaaagaaacttggacaaaattaattggtaat
tttaatgcctataatttattaactgtttatgctgtagcgatgcttttggaagaagatgaa
gacgaaattttgacagaactatcaaatataaaaggtgtaaatggtcgttttcagcgttac
acttcttcgttgggagttcatacgattgtggattatgctcatacgcccgatgcgcttgaa
aatgttttgaagacaataagcgaaatcaaaaaaccacaccaaaaccttattactgttgta
ggctgtggtggaaatagagataaaacaaaacgtccagaaatggcaaaaatagctgctaat
tatagtgattggagtatttttacatctgataatccaagaacagaaaaacctaaagcaatc
ataaaggatatgttagaaggagtaaaagatgtagattgttcaaaatatcaaaccattatt
ttgagaaaagaagccattgaaagagcatgtagtatggcgcaaaaagatgatattattttg
gtagcaggaaaaggacatgaaacttaccaagaaataaatggagaacgttttgattttgat
gatagagtaattttgaaggaatctttggagtaa

DBGET integrated database retrieval system