KEGG   Flexibacter litoralis: Fleli_3033Help
Entry
Fleli_3033        CDS       T02149                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
fli  Flexibacter litoralis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fli00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Fleli_3033
Enzymes [BR:fli01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Fleli_3033
Exosome [BR:fli04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Fleli_3033
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3628136..3629131
Genome map
AA seq 331 aa AA seqDB search
MSFDFQSMRSRPRRNRQSAVIRAMVEETSLSISDFMFPVFVMEGTNKKEPIASMPNIFRY
SLDRLLEEIEECYKLGIRAFAPFPSLTDEYKDAMATSSHNPENIYLKAITAIKEKFPDVF
IMTDIAMDPYSSDGHDGIYKDGKILNDETLEVLGKMAVAQARAGADYVGPSDMMDGRVAY
LRHALDKEGFQDVGIIAYTAKYASAFYGPFRDALDSEPRFGDKKTYQMNPANVREALLEA
KLDIEEGADMIMVKPALSYLDVISKLNQNSNIPIVAYNVSGEYAIVKAGAEKGWIDGEKI
MLETLLSIKRAGAKIILSYFAKEVAQILSKK
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgtctttcgactttcaatctatgcgttctcgccctcgtcgcaatcgtcaatctgctgtc
attcgtgctatggtagaagaaacgtctctttcaatttctgattttatgtttcctgttttt
gtcatggaaggaacaaacaaaaaagaaccgattgcttcaatgccaaatatttttcgttat
tctttagacagacttttagaagaaattgaagagtgctataagttaggaatacgtgctttt
gctccttttccaagtctaaccgatgagtataaagatgcaatggcaacttcaagtcataat
cctgaaaatatatatttgaaagctataacagctataaaagaaaaatttccagatgtcttt
attatgactgatatagcaatggatccttacagcagtgatggacatgatggaatttataaa
gatggaaaaatcttgaatgatgaaacattagaggttttgggtaaaatggctgttgcacaa
gctcgtgcaggtgctgattatgttggtccttcagatatgatggacggaagagtagcatat
ttgagacacgctttagacaaagaaggttttcaagatgtggggataattgcttatacagcc
aaatatgcaagtgctttttatggtccttttagagatgctttagattctgaacctcgtttt
ggagataaaaaaacgtaccaaatgaatcctgccaatgtacgtgaagctcttttagaagca
aaactagatatagaagaaggtgctgatatgattatggtaaaacctgccctttcctatctt
gatgtgattagtaaattaaatcaaaattcaaatattccaattgtggcttataatgtaagt
ggcgaatatgcaatagtgaaagcaggagctgaaaaaggatggatagatggcgaaaaaata
atgttagaaacactactaagcataaaaagagcaggagcaaaaattattttgtcttatttt
gcaaaagaagtagcacaaattttgtctaaaaaatag

DBGET integrated database retrieval system