KEGG   Flexibacter litoralis: Fleli_3080Help
Entry
Fleli_3080        CDS       T02149                                 

Definition
chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
fli  Flexibacter litoralis
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:fli00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Fleli_3080
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Fleli_3080
Enzymes [BR:fli01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Fleli_3080
Two-component system [BR:fli02022]
 CheA family
  CheA-CheYBV
   Fleli_3080
Bacterial motility proteins [BR:fli02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Fleli_3080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3680317..3680916)
Genome map
AA seq 199 aa AA seqDB search
MVKETHLTNKYKAVVIGGSAGSFQPMVQILSSIPREFPLPIFLCLHRLKHVRHGFVEALS
IKSQKEIVEPMDKENIKKGIVYLAPANYHMAVELGNSVSLNTEELINNSRPAIDITFESA
AYVYRDKLIGILLSGANKDGAAGMQKIKLRKGLTIIQDIEESMINAMPLAAKNIVDIDYE
LKVDEIIDFLLKLNKIYQQ
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaagaaacacatcttacaaataaatacaaggcagttgttattggtggttcggca
ggaagttttcaacctatggttcagattctttcttctattcctcgtgaatttccattgcct
atatttctgtgtttgcatcggctcaaacatgttcgtcatggttttgtagaggccctttct
ataaaaagtcagaaagaaattgtcgaaccgatggacaaagaaaatatcaaaaaaggaatt
gtttatttagctccagctaactatcacatggcagtagaacttggaaactctgtttctttg
aatacagaagaattaataaacaattctcgtccagcaatagatattacttttgaatcggct
gcttatgtatatcgtgataaactgattggtatcttactctcaggtgcaaataaagatgga
gctgcaggaatgcaaaaaataaaactccgaaaaggacttactattattcaagatattgag
gaaagtatgattaatgcaatgcccttggctgccaaaaacattgtagatattgattatgaa
ttgaaggtagatgaaattatagactttttattaaaactaaataaaatctatcaacagtaa

DBGET integrated database retrieval system