KEGG   Flexibacter litoralis: Fleli_3118Help
Entry
Fleli_3118        CDS       T02149                                 

Definition
(RefSeq) acyl-CoA synthetase/AMP-acid ligase
Organism
fli  Flexibacter litoralis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3721765..3723459
Genome map
AA seq 564 aa AA seqDB search
MLNIFKKTASLIKEKKFDQLQNLSIEKPEYFNWVEEIFEGIHLVERPDKAALLWTDEVET
VSYSFLQLSEKYNQLLNFLRSKGVKQHDIVLTQLLLQPINWVANLTCIKGGLQLIPTATI
MGVPDLVYRFEKTMPKVVISDQDNAHKIDEAEQESNKKIAVKIICEGKREGWYTLEDIES
QETTAQGAKTKSDDTLFMFFTSGTTGMPKVVCHTHFSYPVGYLTTASWIGLLEDDIHYNI
SQPGWAKFAWSSIFAPWCIGATIFAHHSSNRFNAKTTLKLIEQFKITTLCAPPTVLRLFI
QEDIKSHSFSLRECVAAGEPLNPEIIEAWKEATGVLIRDGFGQTESTCLVANLPDTHVKF
GSMGKPTFLYDIVIADNEGAILSDNEEGNICINMKAGKANGIFKSYLNDSERQAKVFKNN
LYYTGDKAYRDSDGYIWFIGRDDDVIKSSDYRIGPFEIESILLEHEAVIESAAVGSPHPI
KGYEVKVFIVLHENHSASNEIAEILFQHCRKNISPYKTPRIIEFVEELPKTVSGKIRRVE
LRAGEAENKAKKKTSNQEFFYKRK
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgttaaatattttcaaaaaaacagcttctttaattaaagaaaagaaatttgaccaactt
caaaatttatctattgaaaagcctgaatattttaattgggtagaagaaatatttgaagga
atccatcttgtcgaacgaccagataaagcagctttattgtggacagacgaagtagaaaca
gtttcatatagctttttacaactttctgaaaagtacaatcagttacttaattttttaaga
agtaaaggagtaaaacaacatgatattgttttgacacaattattattacaaccaataaac
tgggtagcaaatttgacttgcattaaaggaggtttgcagttgattcctacagctaccata
atgggtgttcctgatttggtctatcgttttgaaaaaacgatgcctaaagtagtaatttct
gaccaagataatgcacacaaaatagatgaagctgaacaagaatctaataaaaaaatagct
gtaaaaattatctgtgaaggaaaacgagaaggctggtacacgttagaagatattgaaagt
caagaaacaacagcccaaggagctaaaacaaaatcagatgatactttatttatgtttttt
acttcaggtacaacaggaatgcctaaagtagtttgtcatacacattttagttatccagtt
gggtatttaacaacagcatcttggataggcttattagaagatgatattcattataatatt
tcacaacctggttgggcaaaatttgcttggagtagtatttttgctccatggtgtattggt
gcaaccatatttgcacatcatagttcgaatcgtttcaatgcaaaaacaacacttaaatta
attgaacaattcaaaataactactttgtgcgcaccaccaacagttttgcgtttgtttatt
caagaagatataaaatcacattctttttctttgcgtgaatgtgttgctgctggcgagcct
ttaaatccagaaataatagaagcatggaaagaagccacaggagtattgattagagatggt
tttggacaaacggaaagtacttgtttggttgctaatcttcctgatacccatgtgaaattt
ggctctatgggaaagccaacttttctttatgatatagtaattgctgataatgagggagct
attttgtcagataatgaagaaggaaatatctgtataaatatgaaggctggcaaagcaaat
ggaatttttaaaagctatttgaatgatagcgaaagacaagcaaaagtatttaaaaataat
ttatattacacaggagataaggcatatcgtgatagtgatggttacatttggttcattggt
agagatgatgatgtcattaaatcttctgactatcgaataggtccttttgagatagaaagt
attttattagaacatgaagctgtaatagaatctgctgctgtgggttctccccatccaata
aaaggttatgaagtaaaagtatttattgttttgcatgaaaatcattcagcatcaaatgaa
atagctgaaatattatttcaacattgtcgtaaaaatatttctccttacaaaacgccacgt
attattgagtttgtagaagaattgccaaaaactgtaagtggcaaaattcgtagagtagaa
ttaagagctggagaagcagaaaataaagcaaaaaagaagacttcaaatcaagagtttttt
tataaaagaaaataa

DBGET integrated database retrieval system