KEGG   Bernardetia litoralis: Fleli_3249Help
Entry
Fleli_3249        CDS       T02149                                 

Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
fli  Bernardetia litoralis
Pathway
fli00860  Porphyrin and chlorophyll metabolism
fli01100  Metabolic pathways
fli01110  Biosynthesis of secondary metabolites
Module
fli_M00121  Heme biosynthesis, glutamate => heme
Brite
KEGG Orthology (KO) [BR:fli00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Fleli_3249
Enzymes [BR:fli01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Fleli_3249
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     Fleli_3249
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO NAD_binding_9 Thi4 Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: AFM05580
UniProt: I4ANP5
Position
complement(3861619..3862983)
Genome map
AA seq 454 aa AA seqDB search
MIAIVGAGISGLSLAWHLHQKNIPYQIFESSGEIGGYLKTVQMGKNKAYLFERGANSLLM
DNEILDFIKKTGFENELIYANKVSKSRFIVRDKKPKKLPSSPQGLLFGSFFSTQTKAKIF
KELYYKKEELDPKITVGEFLENHFGKEVVDYAVSPFVTGIYAADAYQLLLKYTFPILTEY
AQAHGSILKGFIKNKSGDRKQSVSFKNGMQSFAKNISKNLNVQYNHRVISIQNSNFTERK
NRRWLLEIEHNNLGEIKIESLEFDKVFLTTSPSISADLLEPHFEKLAHTIRDIHYPTMCL
IHSVFKKEDVDFDLNGFGALHPKVEGLFSAGTIWSSSVFEGRAPEDEVLFTGFVGGRQWQ
ENAELPKQEILKRHTDELKEIYGIKNDPVVQQFTRWDKSVPQYDEQLLQVEKQLKRLKKS
DIYICANWFGGVSVADCIKKGRDLALQFIADSNL
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgatagcaattgttggcgcaggtatttcaggactttctttggcttggcatttacatcaa
aaaaatataccttatcaaatttttgaatctagtggcgaaataggaggttatttaaaaact
gtccaaatgggaaaaaacaaagcttatttgtttgaacgaggtgcaaactcattacttatg
gataatgaaattcttgattttataaaaaaaacaggatttgaaaatgaacttatttatgcc
aataaagtaagtaaaagtcgttttattgttcgtgataaaaaaccaaaaaaattaccttct
tcaccacaaggattattatttggttcttttttttctactcaaacaaaagccaaaattttt
aaagaattatattataaaaaagaagaattagaccccaaaataaccgtaggagaattttta
gagaaccattttggaaaagaagtcgttgattatgctgtaagtcctttcgtaacagggatt
tatgcagccgatgcttatcaacttttattaaaatatacatttcccatcttgacagaatat
gctcaagcccatggttcaattttgaaaggatttatcaaaaataagtctggagatagaaaa
caatctgtttcttttaaaaatggaatgcaatcttttgccaaaaatatatccaaaaatttg
aatgttcaatataaccatcgtgttatttcaattcagaacagcaattttacagaacgaaaa
aatagacgttggttattagaaatagaacataataatctaggagaaataaaaatagaaagt
ttagaatttgataaagtttttctgactacttcgccttctatttctgctgatttgctagag
cctcattttgaaaagttagcgcatacaattagagatattcattatccaacaatgtgtttg
attcatagtgttttcaagaaagaagatgtagattttgatttgaatggttttggtgcttta
catccaaaagtagaaggtcttttttcggcaggaacaatttggagtagtagtgtttttgaa
gggcgtgcgccagaagatgaggttttatttactggttttgtaggtggaaggcaatggcaa
gaaaatgcagaattaccaaaacaggaaattttgaaacgccatacagatgaattaaaggag
atttatggaataaaaaatgaccctgttgttcagcagtttacacgatgggataaatctgtt
cctcaatacgacgaacaacttttgcaagtagaaaaacaactcaaaaggctcaaaaaatca
gatatttatatttgtgcaaactggtttggtggcgtttcggtggctgattgtatcaaaaaa
ggacgtgatttggcgttgcagtttattgctgattctaatctttag

DBGET integrated database retrieval system