KEGG   Flexibacter litoralis: Fleli_3313Help
Entry
Fleli_3313        CDS       T02149                                 

Definition
Indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
fli  Flexibacter litoralis
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:fli01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:fli00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3940243..3941040
Genome map
AA seq 265 aa AA seqDB search
MLEKIILHKHKEVALLKKEISIESLKQKPFFNRKTISFKNAIRNGSGIIAEFKRKSPSKG
IINDSVDVIEITQGYASAGASALSVLTDTEFFGGQISDLEIARSYNEIPILRKDFMIDEF
QIYRAKASGADLILLIAAVLSPKKCLELAQKAKELNLEILLEIHAEEELEQVKEIAHLVD
AVGVNNRNLKTFTVDIEESMRLFDKIQKIKQGSKNDFVVISESGLSEVETVLKLKEKGFQ
GFLMGEHFMKHQNPAKACKEFIEKL
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaaaaaataatccttcacaaacacaaagaagttgctttactcaaaaaagaaatt
tctattgaaagcctaaaacaaaaacctttttttaatagaaaaacaatttcttttaaaaat
gctattagaaatggttctggaattattgcagaatttaaacgaaaatctccatcaaaagga
ataattaatgattcggtggatgtaatcgaaattacacaaggttatgcttctgctggtgct
tctgcactttctgttttgacagatacagaattttttggtggacaaataagcgatttagaa
attgctcgttcttacaatgaaattcccattttaagaaaagattttatgatagatgagttt
caaatttatcgtgcaaaagctagtggcgcagatttaattttgcttattgctgctgtgctt
tctccaaaaaaatgcttagaattggctcaaaaagcaaaagaattaaatttagagatttta
ctagaaattcacgcagaagaagaacttgagcaagtaaaagaaattgcacatttagtagat
gctgttggtgtaaataatagaaatttgaaaacttttactgttgatattgaggaatcaatg
cgactttttgataaaatacagaaaattaaacaaggaagtaaaaacgattttgtagtaatt
tctgaaagtggactttcagaagtagaaactgttttgaaactcaaagaaaaaggttttcaa
ggttttttgatgggagaacattttatgaaacaccaaaatcctgcaaaagcgtgtaaagag
ttcatagaaaaattgtaa

DBGET integrated database retrieval system