KEGG   Flexibacter litoralis: Fleli_3421Help
Entry
Fleli_3421        CDS       T02149                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
fli  Flexibacter litoralis
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:fli00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:fli00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4062544..4063047
Genome map
AA seq 167 aa AA seqDB search
MKISIITARSKNGVIGSNNSLPWKMPSDMRFFKQTTIGHHVLVGRKTYQSFNVQLVERPA
LILTTKSDYQPKYKEDQTINSLEEGIKKAKEQNETELFIIGGGEIYKQALDKNLVTNMYI
TELDAIIEGDTFFPNFEESEWNVVRNDSFAAGEKNDYDYSFVLYEKK
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattagtattataacagcacgctcaaaaaatggcgtaattggttcaaataattct
cttccttggaaaatgccttctgatatgcgtttttttaaacaaacaactattgggcatcac
gttttagttggaagaaaaacatatcaaagttttaatgttcaacttgtagaacgtcctgca
cttatcttgacaacaaaatcagattatcagccaaaatataaagaagaccaaactataaac
tctttagaagagggaatcaaaaaagcaaaagagcaaaatgaaaccgaactttttattatt
ggtggtggagaaatctataaacaagccttagataaaaatctagttacaaatatgtacatt
acagaacttgatgcaattatagaaggtgacactttttttccaaattttgaagaatcagaa
tggaatgttgtcagaaatgacagttttgcagcaggtgaaaaaaatgattatgattatagt
tttgtcttgtatgagaaaaaataa

DBGET integrated database retrieval system